(data stored in ACNUC30630 zone)

EMBL: CP001738.PE13

CP001738.PE13        Location/Qualifiers
FT   CDS_pept        complement(17587..18336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95622"
FT                   /db_xref="GOA:D1ADB2"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95622.1"
FT                   /translation="MNTALIFTFSNNVDIYINSILHLGDKYAVSKFSFIFVTGATIEGP
FT                   STDFADKIVSGLEDLSAGIYKNSSIEIDDRIKSRCAATVDNLKASQSNQELAQPVPLEE
FT                   LEKFLERQSKQARPGRLFIDVTGLPKVLMSHVMLIGIAGGHETYAFELHKQPDRAHPEK
FT                   SLYFFIPPGGFSYYPLRQSPAVQSVFRKLIHVRRILRTTTATLIVGIICFSILTFIDSQ
FT                   NPILATIGLVSNLIGIASGIYQMRSPR"
     gtgaataccg cgcttatctt taccttctca aacaacgttg acatctacat taattccatc        60
     ttgcaccttg gcgacaaata tgctgtctca aaattctcct tcatattcgt cacaggagca       120
     acaatagagg gcccctcaac cgacttcgcc gacaagatcg tatctggact agaagacctc       180
     tcggcaggaa tatataagaa ttcctccata gagatcgatg acaggatcaa atctcgctgt       240
     gcagctactg tagacaatct caaggcaagc cagtcaaacc aggagctggc tcagccagtt       300
     ccactggaag aactggagaa gttcctagaa agacaatcaa agcaggccag gcctggaaga       360
     cttttcattg atgtcaccgg gctaccaaag gttctcatgt cccacgttat gctgatcgga       420
     attgccggcg gccacgaaac gtatgctttt gagctgcaca agcaaccaga cagagcacac       480
     cccgagaagt ctttgtactt ctttatccca cctgggggat tttcctacta tccactcaga       540
     caatccccgg cagtacaatc tgtcttccga aaactcatcc acgtgcgaag gattttgcga       600
     acgacaacag ccactttgat agttggcatc atctgctttt caatactaac cttcatcgac       660
     tcacaaaacc ctatactcgc cacaatcgga cttgtctcca atctaattgg aatagccagc       720
     ggcatatatc agatgcgatc cccgagataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page