(data stored in ACNUC30630 zone)

EMBL: CP001738.PE130

CP001738.PE130       Location/Qualifiers
FT   CDS_pept        complement(142210..143388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0132"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   mch:Mchl_4629 protein-L-isoaspartate O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95739"
FT                   /db_xref="GOA:D1AEC3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEC3"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACY95739.1"
FT                   /translation="MTPATTTTPEWLAEAVASGRLDAGWVQVFAALPRSLFLPDVIWPK
FT                   DPDSGQNVRVDRRRDPSGWAAWAEQDVPIVTQWDDQPDPAAAGQTATSSSSQPSLVAGM
FT                   LADLDVRPGHRVLDLGVGTGWTTALLAARVAAGTVVGIEYDPAVAEAARARITAVGLVA
FT                   DVIVGDGAAGWPDGAPYDRVQCTYAVRRIPTAWVEQTRPGGVILAPWETTLTHQGALVR
FT                   LTVQEDGIASGPFLWPVRFMGSRPERTPQIDRNDYLPPGGGWPPGTVESATRLRPADLW
FT                   ATPYGPAWWMIGLLVPDMVYATSSRKDGTVLGWLFSLRCRSWAIAFFDDAPEAEVYQGG
FT                   PRRLWDEVEAAHRWWTEQGRPGHEDFGLTVGPDGERVWLRSPDRPLPATLAG"
     gtgacccccg cgaccaccac gacacctgag tggctggccg aggcggtcgc ctccgggcgg        60
     ttggacgccg gatgggtaca ggtgttcgcc gcgctgcccc ggtcgctgtt ccttcccgac       120
     gtgatctggc cgaaggatcc ggacagcggt cagaacgtgc gcgtcgaccg ccgccgggat       180
     cccagcggct gggcggcctg ggctgagcag gatgtcccga tcgtcaccca gtgggacgac       240
     cagcctgacc cggccgcggc cgggcagacg gcgacttcct cgtcatcgca accgtcgttg       300
     gtcgctggga tgctcgccga cttggacgtc cgccccgggc accgggtctt ggatctcggt       360
     gtcgggaccg gttggaccac cgctctgctg gccgcccggg tcgcagcggg cacggtggtc       420
     ggcatcgagt acgacccggc cgttgcggag gcggcccggg cccgcatcac ggccgtgggc       480
     ctggtcgctg atgtgatcgt gggggacggt gccgccggct ggccggacgg cgctccttat       540
     gaccgcgtcc agtgcaccta cgcggtccgg cgcatcccta ccgcgtgggt ggagcagacc       600
     cgccccggcg gggtgatcct cgcaccgtgg gaaaccaccc tcacccacca aggcgccctg       660
     gtccgcctca ccgttcaaga agacggcatc gcctccggcc cctttctatg gccggtgcgg       720
     ttcatgggct cccgcccgga acgcacacca cagatcgacc ggaacgacta cctcccgccc       780
     ggcgggggct ggccgcccgg caccgtcgaa tcggccactc ggctgcgtcc ggccgaccta       840
     tgggccactc cctatggccc ggcgtggtgg atgatcggcc tgctggtccc cgacatggtg       900
     tacgccacca gcagccgcaa ggacggcacg gttttgggct ggctgttcag cctgcgatgc       960
     cggtcctggg ccatcgcgtt cttcgacgac gcccccgagg ccgaggtcta ccagggcggc      1020
     ccccgccgcc tgtgggatga ggtcgaggcg gcccaccggt ggtggaccga acagggacgg      1080
     cccggccacg aggacttcgg gctgaccgtc ggcccggacg gcgaacgggt gtggctgcgc      1140
     tccccggacc ggccgctgcc tgcgaccttg gcggggtaa                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page