(data stored in ACNUC30630 zone)

EMBL: CP001738.PE14

CP001738.PE14        Location/Qualifiers
FT   CDS_pept        complement(18333..18656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95623"
FT                   /db_xref="InterPro:IPR040942"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95623.1"
FT                   /translation="MYVITENKNKLRELSQEFENLINELFNQINKNPSIKVLLHGGDSI
FT                   LLEMPRSEIETTVNLIRTTSRGTSFTFSGGYGKTMRDAYLALKLAKATGKNKIIPFTPE
FT                   TLR"
     gtgtacgtta taacagagaa caaaaataag ctaagggaac tctctcaaga atttgagaac        60
     ctaataaacg agctcttcaa tcaaattaac aaaaacccct ccatcaaagt cctcttgcat       120
     ggcggagaca gcatactcct ggaaatgcca agatcagaaa ttgagacaac agtcaacctg       180
     atccgtacca cgtccagagg aacaagcttt accttttccg gcggctacgg aaagacaatg       240
     cgcgatgcct acctggccct caagctggca aaggccaccg ggaagaacaa gatcatcccg       300
     ttcacgccgg agacactacg gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page