(data stored in ACNUC30630 zone)

EMBL: CP001738.PE144

CP001738.PE144       Location/Qualifiers
FT   CDS_pept        157351..157944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0146"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   regulatory protein LuxR; sigma-70 region 4 domain protein;
FT                   KEGG: bac:BamMC406_4381 ECF subfamily RNA polymerase
FT                   sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95753"
FT                   /db_xref="GOA:D1AED7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED7"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACY95753.1"
FT                   /translation="MNRAQQEEFHRYVADRGPVLLRAARQLTGDRTEAEDLLQVALAKT
FT                   YLAWDRINDRAAVDGYVRRAMVNTHISWWRRRKLEIYPTDVLPDRPVDDHTRRSEMHDA
FT                   LSRALARLPERQRLAVILRYYEDLPEPEIAKVLGVSVGTVKSTVSRAMAKLREDVDLEH
FT                   DFTAPKAAKEPDPPSERGALPDARHAPDTSERDR"
     gtgaacaggg cccagcagga ggagttccac cggtacgtcg cagaccgggg gcccgtgctg        60
     ctgcgcgccg cccggcagct caccggcgac cgcaccgagg ccgaggacct gctgcaggtg       120
     gcgctggcca agacctacct ggcctgggac cgcatcaacg accgcgcggc ggtggacggc       180
     tatgtgcggc gggccatggt caacacgcac atctcctggt ggcggcgccg caagctggag       240
     atctacccca ccgatgtgct gcccgatcgg ccggtggacg accacacccg gcgcagcgag       300
     atgcacgacg ccctctcccg cgccctggcc aggctgcccg agcggcagcg cctggcggtc       360
     atcttgcgct attacgagga cctgccggaa ccggagatcg ccaaggttct cggcgtgagc       420
     gtgggaacgg tcaaaagcac cgtctcccgg gcgatggcca agctccgcga ggacgtcgat       480
     ctggagcacg acttcaccgc ccccaaggcc gccaaggagc cggacccccc gtccgagcgc       540
     ggcgcgctcc cggacgcccg ccacgccccg gacacctccg agcgcgaccg gtga             594
//

If you have problems or comments...

PBIL Back to PBIL home page