(data stored in ACNUC30630 zone)

EMBL: CP001738.PE146

CP001738.PE146       Location/Qualifiers
FT   CDS_pept        158693..160450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0148"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; KEGG: GOX4; glyoxal
FT                   or galactose oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95755"
FT                   /db_xref="GOA:D1AED9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D1AED9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACY95755.1"
FT                   /translation="MPRWSSGTPDADRRLVQGLHQGDEETLGVLYDTYAEQLFDYCVAM
FT                   VAEERRAADIVHDAFIDAQRRAPRMRNRMQLRAWLYAAVRRRCLRGGRAAGMSWRWAAA
FT                   SAWAQEPGAAEAEVTPEEARRLVEAMLGRLDFLHRETLVLTLRHGMSPADISAVLGVSA
FT                   RRVAALVAQAEARAEAAITAELRAMVRHCHARRDSRERSQSDPAAEPQEAPEEQPVPAG
FT                   AAGGGSPVTALRHRSAVRLLASGGTFRRRRLRRSGTGRADLEPQLARHLADCTECWRRG
FT                   RVAAGSLLKAAPAPVPPAALRRRVLHTATDPELAPHRTDIAARGGPLTPAGLPRQPDMP
FT                   SPYARRWLFLGGGAAGALLAAMVAILMMGPVTANLRFPFDPRPQPSTEEAREKGAESGD
FT                   HPALAAPGAGGMPGPGGGYGRTPSPGPPFGEVPPDEPPEDRTPQPPGPDPSGPPGPSPS
FT                   PNPTQPPDPSQPPQPPYPSQPPLPSPSPPPAEGRLVVGPASVVVGRQGATITLTAQDGP
FT                   VVWTAVTTSDKLSLSLGSGTLQAGASVELQVVLARRSLINLPGNAAITVTDAAGNRHEV
FT                   QVKWRLSLF"
     atgcctaggt ggtcttccgg aaccccggac gccgatcgtc ggctcgtcca ggggttgcac        60
     cagggagacg aagagacgct gggcgtcctc tacgacacct atgccgagca gctcttcgac       120
     tactgcgtcg ccatggtcgc ggaggagagg cgggcggccg acatcgtcca cgacgccttc       180
     atcgacgccc agcgccgcgc tccgcgcatg cgcaaccgga tgcagttgcg cgcctggctt       240
     tacgccgccg tccggcggcg ctgcctgcgg ggaggccggg ccgccggcat gtcctggcgg       300
     tgggcggcgg cgtcggcctg ggcgcaggag ccgggcgccg ccgaggcgga ggtgacgccc       360
     gaagaggccc gccgcctggt ggaggcgatg ctgggacggc tggacttcct gcaccgggag       420
     accctggtgc tgacgctgcg gcacggcatg agccccgccg acatctccgc cgtcctgggg       480
     gtgtcggcac gccgcgtcgc cgccctggtg gcccaggccg aagcgcgcgc cgaggcggcg       540
     atcacggccg agctgcgcgc gatggtgcgg cactgccatg cccggcggga ctcccgggaa       600
     cggtcccagt ccgatcccgc cgccgagccg caggaggctc ccgaggagca gccggtgccg       660
     gccggtgccg ccggaggcgg ttcgccggtc accgcgctgc ggcaccgctc cgccgtgcgc       720
     cttctcgcct ccggcggaac gttccgcagg cggcgcctca gacgctccgg caccggccgg       780
     gcggacctgg aaccccagct ggcccggcat ctggccgact gcaccgagtg ctggcggcgc       840
     ggccgggtgg ccgccgggag tttgctgaaa gcggcgccgg ccccggtgcc gccggccgcg       900
     ctccggcgcc gggtgctgca caccgccacc gacccggagc tggcccccca ccgcaccgac       960
     atcgccgcgc gcggcggtcc gctgaccccc gccgggctgc cccgccagcc cgacatgccc      1020
     tccccgtacg cccggcgctg gctgttcctg gggggcggcg cggccggcgc gctgctggcc      1080
     gcgatggtgg cgatcttgat gatggggccg gtcaccgcga atctgcgctt tccgttcgac      1140
     ccgcgccccc agccgtccac cgaggaggcg cgggagaaag gggcggagag cggcgaccac      1200
     ccggcgttgg cggcgccggg cgccggcggt atgccggggc ccggcggcgg gtacggccgg      1260
     acgccctcgc cgggtccgcc cttcggtgag gtcccgcccg acgagccgcc ggaggaccgc      1320
     actccgcaac cgccggggcc ggatccgtcc gggccgcccg gcccgtcccc gtcgccgaac      1380
     ccgacccagc cgccggatcc ctcgcagccc cctcaacctc cctacccgtc ccagccgccc      1440
     ctgccgtcgc cgtctccgcc gcccgcggaa gggcggctgg tcgtcggccc ggcctcggtg      1500
     gtcgtgggcc ggcagggcgc caccatcacg ctcaccgccc aggacggccc ggtcgtctgg      1560
     accgcggtca ccaccagcga caagctgagc ctgtcactgg ggtcggggac gctgcaggcg      1620
     ggcgcctcgg tcgagctgca ggtggtgctg gcccggcgtt cgctgatcaa tctgcccggc      1680
     aatgccgcga tcacggtgac cgacgcggcg ggcaaccggc acgaggtcca ggtgaagtgg      1740
     cggctgtcgc tgttttga                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page