(data stored in ACNUC30630 zone)

EMBL: CP001738.PE147

CP001738.PE147       Location/Qualifiers
FT   CDS_pept        complement(160455..161201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0149"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: pap:PSPA7_1798 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95756"
FT                   /db_xref="GOA:D1AEE0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE0"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACY95756.1"
FT                   /translation="MADYRIDDLARAAGTTVRNVRAYQDRGLLPPPRLRGRVGYYDDSH
FT                   LARLRLIGQLLARGYTLAVIKELLLAWEHGRDVSEVLGLEKVLTDPWSEELPGQVTVEE
FT                   LVASFGKGLAEEEIGPLLERATALGLIEPEGDRYRVPSPRLLHVGAELVAAGIPVAAVL
FT                   DVAERIRDDCEVIADRFVSLVGEHVFARMDGPGGDLAPAELAALVRRMRPLVKTVVEPF
FT                   IARAMEARVQQALGERMEVIREHLGP"
     atggccgact accggatcga cgacctggcc cgcgcggccg ggacgaccgt ccgcaacgtc        60
     cgcgcctacc aggaccgcgg gctgctgccg ccgccccgcc tgcgcggccg ggtcggctac       120
     tacgacgact cccacctggc ccggctgcgg ctgatcggcc agctgctggc gcgcggctac       180
     accctggcgg tcatcaagga actgctgctg gcctgggagc acggcaggga cgtcagcgag       240
     gtcctcggcc tggagaaggt gctcaccgac ccctggtcgg aggagctgcc cggccaggtg       300
     acggtcgagg agctggtggc ctccttcggc aaggggctgg cggaggagga gatcggcccg       360
     ctgctggagc gggccaccgc gctgggcctg atcgagcccg aaggcgaccg ctaccgggtg       420
     cccagccccc ggctgctgca cgtgggcgcc gagctggtcg ccgccgggat ccccgtggcc       480
     gcggtgctgg atgtcgccga gcggatccgc gacgactgcg aggtgatcgc cgaccggttc       540
     gtctccttgg tcggcgagca cgtcttcgcc cggatggacg ggccgggcgg cgacttggcg       600
     ccggccgagc tggccgcgct ggtgcggcgg atgcgcccgc tggtgaagac ggtggtggaa       660
     ccgttcatcg cccgggccat ggaggcccgc gtccagcagg cgctgggcga gcggatggaa       720
     gtgatccgcg agcacctcgg gccctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page