(data stored in ACNUC30630 zone)

EMBL: CP001738.PE149

CP001738.PE149       Location/Qualifiers
FT   CDS_pept        complement(162338..163189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95758"
FT                   /db_xref="GOA:D1AEE2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95758.1"
FT                   /translation="MELGRIGIWTPALRTRRPKAPEPIAEAVAELEELGYGAIWLGGSP
FT                   GVQSARVLIEASSRIVVATGILSVWDHPASEVAAQHRALAHDHPGRFLLGLGISHGPAV
FT                   GDRYRRPYATMMSYLDELDAAGVPAAERVLAALGPKMLAAARDRAAGAHPYLVTPEHTH
FT                   RARQVLGDGPLLAPEVKVVLDTDLERGRRSARDHLSFYLQLPNYTNNLLRLGFTEEDFA
FT                   GGGSDRLIDAVFAIGDVEAAERRIAEHFQAGADHAAVQVITADYRTLPLEQWRALAPLA
FT                   KQ"
     atggaactcg gacggatcgg catttggact cccgcgctgc ggacccggcg gcccaaggcc        60
     cccgagccga tcgcggaggc ggtcgccgag ctggaggagc tcggctatgg ggcgatctgg       120
     ctgggcggca gcccgggggt gcagtcggcc cgggtgctca tcgaggcctc ctcccgcatc       180
     gtggtggcca ccgggatcct cagcgtctgg gaccatccgg cctcggaggt ggccgcccag       240
     caccgggcgc tcgcccacga ccatcccggg cgcttcctgc tggggctggg catcagccac       300
     gggccggcgg tcggcgaccg ctaccgccgt ccgtacgcga cgatgatgag ctacctggat       360
     gagctggacg ccgccggggt gccggccgcc gagcgggtgc tggccgcgct cggcccgaag       420
     atgctggcgg cggcccggga ccgcgccgcc ggcgcccacc cgtacctggt cacccccgag       480
     cacacccacc gggcccggca ggtgctgggg gacgggccgc tgctggcccc cgaggtgaag       540
     gtggtgctcg acaccgacct ggagcggggc cgccgcagcg cccgcgacca tctgtccttc       600
     tacctgcagc tgcccaacta caccaacaac ctgctgcgcc tgggcttcac cgaggaggac       660
     ttcgcgggcg gcggcagcga ccggctgatc gacgcggtct tcgcgatcgg cgatgtggag       720
     gcggccgaac ggcgcatcgc cgagcacttc caggccggcg ccgaccacgc cgccgtccag       780
     gtcatcaccg ccgactaccg gaccctgccg ctggagcagt ggcgcgccct ggccccgctg       840
     gccaagcagt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page