(data stored in ACNUC30630 zone)

EMBL: CP001738.PE15

CP001738.PE15        Location/Qualifiers
FT   CDS_pept        complement(20821..21687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0016"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rec:RHECIAT_PB0000111 putative carboxylesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95624"
FT                   /db_xref="GOA:D1ADB4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACY95624.1"
FT                   /translation="MSRISPVTGHYVTVEVDGLEYKVFYLENGTGQPLVCQHTAGCHNH
FT                   QWRGLLEDEQIASDYRIIAYDLPRHGKSDPPENTEWWKEEYKLTAEHYTNFIIAFCDAL
FT                   DLKDPIFMGCSFGGNVALQLALRRPDRFAGIIAVEGADYSPGFYLDWWQHPHANAAQVC
FT                   ASGVWDLMAPQSPEADRRKTWFYYTQGSEAFKGDLYFYSVDHDLRDRLGEIDGDRCPLV
FT                   MMTGEYDYLTTPEDSARTAKAIKNCTFLKMEKIGHFPMSENYPVFRLYLLEALRILKQR
FT                   RKTPVPA"
     atgagcagga tctctccggt aaccgggcac tatgtgaccg tcgaggtgga cggcctggaa        60
     tacaaggtct tctacctgga gaacggcacc ggacagccgc tggtctgcca gcacaccgcg       120
     ggctgtcaca accaccagtg gcgcggcctg ctggaggacg aacagatcgc ctccgactac       180
     cggatcatcg cctacgacct gccccgccac ggcaagtccg acccgcccga gaacaccgag       240
     tggtggaagg aggagtacaa gctcaccgcc gagcactaca ccaacttcat catcgccttc       300
     tgcgacgccc tggacctgaa ggacccgatc ttcatgggct gctcgttcgg cgggaacgtc       360
     gccctgcaac tggccctgcg ccgcccggac cgcttcgccg gcatcatcgc ggtggagggc       420
     gccgactact cgcccggctt ctacctggac tggtggcagc acccgcacgc caacgccgcc       480
     caggtgtgcg ccagcggggt gtgggacctg atggcacccc agtcccccga agccgaccgc       540
     cgcaagacct ggttctacta cacccagggc tctgaggcgt tcaagggcga cctgtacttc       600
     tactcggtcg accacgacct gcgcgaccgc ctcggcgaga tcgacgggga ccgctgcccg       660
     ctggtgatga tgaccggcga gtacgactac ctgaccaccc cagaagacag cgcccgcacc       720
     gccaaggcca tcaagaactg caccttcctg aagatggaga agatcggcca cttccccatg       780
     agcgagaact acccggtctt ccgcctctac ctgctggagg ccctccgcat cctcaaacag       840
     cgccgcaaga cacccgtccc cgcctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page