(data stored in ACNUC30630 zone)

EMBL: CP001738.PE152

CP001738.PE152       Location/Qualifiers
FT   CDS_pept        165224..165958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0154"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95761"
FT                   /db_xref="GOA:D1AEE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEE5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACY95761.1"
FT                   /translation="MTDETAAHPQGRVVSEPAQGRPDGPAKTRILLADDHALVRRGVRL
FT                   ILDGEPDLWVVGEAGDGAEAIEQVRRRAGTPQEVDLAVLDVAMPRMTGLQAARELSRMY
FT                   PRLRILILTMHDNEQYLFEALKAGAAGYVLKSLADRDLVQACRAAVRGEPFLYPGAISV
FT                   LIRSYLEQARQGEEPETPLTPREEEILKLVAEGHSSREIADTLFISVKTVERHRANILA
FT                   KLGMKDRLELTRYAIRTGLIEP"
     atgaccgacg agacggcggc ccacccgcag gggcgggtcg tctccgagcc ggcccagggc        60
     cgcccggacg gcccggccaa gacgcgcatc ctgctcgccg acgaccacgc gctggtgcgg       120
     cggggcgtgc ggctcatcct ggacggcgag ccggacctgt gggtggtcgg cgaggccggg       180
     gacggcgccg aggcgatcga acaggtgcgg cgtcgggcgg gcacgccgca ggaggtcgat       240
     ctggccgtgc tggatgtggc gatgccgcgg atgaccggcc tgcaggccgc ccgggagctg       300
     tcgcggatgt atccgcggct gcggatcctc atcctcacca tgcacgacaa cgagcagtac       360
     ctgttcgagg cgctcaaggc cggggcggcc gggtatgtgc tcaagtcgct ggccgaccgc       420
     gatctggtgc aggcttgccg ggcggcggtg cgcggcgagc cttttttgta ccccggcgcg       480
     atcagcgtgc tgatccgcag ctacctggag caggcccgcc agggggagga gccggagacg       540
     ccgctcaccc cgcgcgagga ggagatcctc aagctggtcg ccgagggcca ctcctcccgg       600
     gagatcgccg acacgctgtt catcagcgtc aagaccgtcg agcggcaccg cgccaacatc       660
     ctggccaagc tcggcatgaa ggaccgcctg gagctgaccc gctacgccat ccgcaccggc       720
     ctgatcgagc cgtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page