(data stored in ACNUC30630 zone)

EMBL: CP001738.PE16

CP001738.PE16        Location/Qualifiers
FT   CDS_pept        complement(21702..22115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95625"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95625.1"
FT                   /translation="MTMTAPTLTRTAQQWADAFAKASNEDPEIQAHGKDFTCSYLLDAT
FT                   DQAFVIRVESGRVVQVAVDPGPLDVRYQFAIRASAETWRNFSKPEPPPMFHGIWAASFQ
FT                   RDMRLEGDLLVLMQNLRCITRQLELLRTVGSPV"
     atgacgatga ccgcaccgac cctgacccgc acggcccagc agtgggccga cgccttcgcc        60
     aaagccagca acgaagaccc cgagatccag gcccacggca aggacttcac ctgctcgtac       120
     ctgctggacg ccaccgacca agccttcgtg atccgcgtgg agtccgggcg ggtggtccag       180
     gtcgccgtcg acccggggcc gctcgatgtg cgctaccagt tcgccatccg ggcgagcgcg       240
     gagacctggc gcaacttcag caagccggaa ccgccgccga tgttccacgg gatctgggcc       300
     gccagcttcc agcgcgacat gcgcctggaa ggcgacctgc tggtcctcat gcagaacctg       360
     cgctgcatca cccgccagct ggagctgctg cgcaccgtcg gctccccagt ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page