(data stored in ACNUC30630 zone)

EMBL: CP001738.PE160

CP001738.PE160       Location/Qualifiers
FT   CDS_pept        complement(172804..173361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0162"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_5253 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95769"
FT                   /db_xref="GOA:D1AEF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEF3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACY95769.1"
FT                   /translation="MYPVMVHGERLVLREFTEADIDAVLAIYGDPVVTEHLSFEPRTRD
FT                   QVAATIRTVTQAARAVPRTEYSLAAALISTGEAIGFARLAVDTGHPGQSSAQLGFALRK
FT                   DHWGQGLGSEMLGLLLTLGFDHLGLHRLWGARSPANTTSARLMLKHGMVEEGRIRHHLR
FT                   IGGQWRDSIVHSILEHERRPSP"
     atgtacccgg tcatggttca tggcgaacgc ctcgtcctgc gtgagttcac cgaagccgac        60
     atcgatgccg tactggccat ctacggcgac cctgtggtca ccgaacatct cagcttcgaa       120
     cctcgcaccc gcgaccaggt ggccgccacc atccggaccg tcacccaagc cgcccgcgcc       180
     gttccgcgga ccgagtattc cctggccgcc gcgctgatct ccaccggcga ggccatcggt       240
     ttcgcccggc tggccgtcga caccggtcac cccggccagt ccagcgccca gctcggtttc       300
     gcccttcgca aagaccactg ggggcaaggg ctgggctcgg agatgctcgg tcttctcctc       360
     accctcggtt tcgaccattt ggggctgcac cggctctggg gcgcgcgttc cccggccaac       420
     accacctcgg cccgcctcat gctcaaacac ggcatggtcg aagaaggccg gatccgtcac       480
     cacctgcgca tcgggggcca gtggcgcgac tccatcgtcc actccattct cgaacacgaa       540
     cgccgcccca gcccttga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page