(data stored in ACNUC30630 zone)

EMBL: CP001738.PE169

CP001738.PE169       Location/Qualifiers
FT   CDS_pept        186781..188775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0172"
FT                   /product="DNA sulfur modification protein DndD"
FT                   /note="TIGRFAM: DNA sulfur modification protein DndD; PFAM:
FT                   SMC domain protein; KEGG: dal:Dalk_4797 DNA sulfur
FT                   modification protein DndD"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95778"
FT                   /db_xref="InterPro:IPR017599"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG2"
FT                   /inference="protein motif:TFAM:TIGR03185"
FT                   /protein_id="ACY95778.1"
FT                   /translation="MLLHNVTLKNFGAYKGEQSLELTTEPGRPIILIGGLNGCGKTTLL
FT                   DAIQLALYGARARTSGRGNRSYESYLRDSINRQANPKHAHVTVEFSLAIEGRERRYKVR
FT                   RSWEANGKNVREFLNVLVDGELDLVVSDNWADHIEDILPLEAASLFFFDGEKIESLADP
FT                   ERAAPVIESAVYSLLGVNTVEQLRTDLLALQRRQKVPDEDKQALERIQQLEREIREVDQ
FT                   LCADTNQKAAAARDALQRAEAHFSAVDEAFSKEGGDLYSRRAELEAEKEQAEAHLRSIN
FT                   ETLANTLAPGPLPLLLLGPQVVALQKQVQKERTAAKNAQVIEILNERDHLLLETLKDLV
FT                   PAEGLAAAEKYLAEDRQRRAKETAETRQVLNFPADSFPQLVSLDEVLRQEAKRARELVD
FT                   QAQELRERLDILERQLAGVPDKTVIAALIEERDAARDQVTRHRLALAAAEEELSAARRR
FT                   REQLLSERERAYKGRAQKLAKAEAAARIISYADRVRDTLEKFKTALLRRHINRLEVAVL
FT                   DSFNRLMRKSELVRDLRIDTEKFTLTLIGPDDEKLAPSRLSAGERQLLAVSLLWGLARV
FT                   AGNRLPSVIDTPLGRLDSRHREHLVERYFPHASHQVLLLSTDEEIDEYLLGKLKPSISH
FT                   SYTLVHDDKNFTTTVEPGYWWGTGAIHVA"
     atgctcctgc ataacgtcac ccttaagaac ttcggcgcct acaagggcga gcagtctctt        60
     gagctcacca ccgaaccggg acgtccgatc atcttgatcg gagggctcaa cgggtgcggt       120
     aagaccactt tgctggacgc gatccagctg gccctctatg gtgcccgggc gcgtaccagt       180
     ggccgcggca accgctccta tgagagctac ctgcgtgaca gcatcaaccg gcaggcgaac       240
     cctaagcatg ctcatgtgac cgtcgagttc tccctggcca tcgaggggcg ggagcgacgt       300
     tacaaagtgc gtcgcagctg ggaggccaac ggcaagaacg tccgtgagtt cctcaacgtt       360
     ctggtcgatg gtgagctcga ccttgtggtc agtgacaact gggccgacca catcgaggac       420
     attctgcctc tggaagccgc ctcgctgttc ttttttgacg gcgagaagat cgagtcgctc       480
     gccgaccccg agcgggcggc cccggtgatc gaatcggcgg tctactcgct cctgggtgtc       540
     aacactgtag agcagcttcg cactgacctg ctggccctgc aacgtcggca gaaggtcccg       600
     gacgaggaca agcaggcgct tgaacgaatt cagcaactag aacgtgagat ccgtgaggtc       660
     gatcaactgt gcgccgatac aaatcagaag gcggcagcgg cccgggacgc tcttcagcga       720
     gccgaggctc acttctccgc cgtggatgag gccttctcca aagagggggg cgacctctat       780
     agccggcgtg cagagctgga ggcggagaaa gaacaagcag aagcccacct ccgcagcatc       840
     aacgaaacgc tcgccaacac actggccccc ggtcctcttc ctctcctgct gctcggccct       900
     caggtggtcg ctttgcagaa acaggtgcaa aaggagcgga ccgcggccaa gaatgcccag       960
     gtcattgaga tcctgaacga gcgggaccac ttgctccttg aaactctcaa ggaccttgtg      1020
     cccgccgaag ggctcgcagc cgctgagaag taccttgccg aagaccgtca gaggcgcgcc      1080
     aaggagacgg cggagacccg gcaggtactg aacttcccgg ccgactcctt cccacagctc      1140
     gtttctttgg acgaggtcct ccgccaagag gcgaaacggg cccgggagct cgtcgatcaa      1200
     gcacaggagc tgcgagagcg tcttgacatt cttgaacgcc aactggccgg cgtgccggac      1260
     aagaccgtca tcgccgctct gatcgaggag cgggacgcag cccgggatca ggtgacccgg      1320
     caccgtctcg cactggccgc agcggaagag gaactgtctg cggcccgacg gcgccgtgag      1380
     cagcttctgt cggagcggga gcgtgcctat aagggacgtg cccagaagct tgccaaggct      1440
     gaggccgccg cccgcatcat ttcctacgcc gaccgcgtcc gcgacacctt ggagaagttc      1500
     aagacggcct tgctgcggcg gcacatcaac cggctcgagg tcgcggtctt ggacagcttc      1560
     aaccgtctca tgcgcaagag cgagctggtc cgcgatcttc gcattgacac ggagaagttc      1620
     accctcacct tgatcggacc cgatgacgag aagctggctc cgtcgcgact cagcgccggt      1680
     gaacgccagc tcctcgccgt ttctcttctc tgggggcttg cacgggtcgc cggaaaccgt      1740
     cttcccagtg tgatcgacac tccgctgggg cgtctcgaca gccggcaccg cgaacacctt      1800
     gtggaacgct acttcccgca tgccagccac caggtcctgc tgctgtccac ggacgaggag      1860
     atcgacgaat acctcctcgg gaagctgaag ccgtcgatct cccattccta cactctggtt      1920
     cacgacgaca agaacttcac gacgaccgtc gaacccggct actggtgggg cacgggggcc      1980
     atccatgtcg cttga                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page