(data stored in ACNUC30630 zone)

EMBL: CP001738.PE174

CP001738.PE174       Location/Qualifiers
FT   CDS_pept        196591..196800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95783"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEG7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95783.1"
FT                   /translation="MSGFWCDGEWRRKELISTVGRWLNSAIGLQGISLDSSRGVDCFGW
FT                   AAKAMNVSAEDFPAFACWSDQIGL"
     atgtccggat tctggtgtga cggcgaatgg cggcggaagg agctcatctc cacagtgggc        60
     cgatggctga attcagccat cggattgcag gggatatcac ttgactcctc taggggagtt       120
     gattgtttcg gctgggccgc gaaggcaatg aacgtatcgg cggaagactt ccccgcgttc       180
     gcctgttgga gcgaccagat cgggctctga                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page