(data stored in ACNUC30630 zone)

EMBL: CP001738.PE18

CP001738.PE18        Location/Qualifiers
FT   CDS_pept        23007..24161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0019"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: mxa:MXAN_3398 FAD-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95627"
FT                   /db_xref="GOA:D1ADB7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADB7"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACY95627.1"
FT                   /translation="MRKAIVIGGGIGGLTAAAALKGKGWTVRVYERAPGLEPVGSGLAI
FT                   GPNALRALDTLGIGDRVRDLAALAGDGGLQRPGGGWLSRTSAEDAAVRYGDLTVIMLRS
FT                   RLVSLLSGLLETDDLHLGVTVESVSPDDGTVITDRRADRADLIVAADGIGSRTRAALFP
FT                   GHPGPRYFGLTAWRLLTADPGTIEAFSETWGRGLLFGVTPLADGMLYCYAAAPAPAGRR
FT                   APDEKRELLRLFGTWHDPIPGLLAQADPARILRNDIYFMEPPLPAFHRGRVVLLGDAAH
FT                   PMTPHLGQGACQAIEDAIVLAHEVTDGGGPAAYTAARLPRTTEIMRRSRRIGRLAALQN
FT                   PLLVALRDAAMWTANRLGPSLVLRQGDPVFAWRPPAAAAGLIRR"
     atgcggaagg cgatcgtgat cggcggcggg atcggcgggc tcaccgccgc ggcggcgctc        60
     aaaggcaaag gctggacggt gcgcgtctac gaacgcgccc ccggcctgga accggtcggc       120
     tcgggcctgg ccatcggccc caacgcgctg cgcgccctgg acaccctggg catcggcgac       180
     cgggtgcgcg acctggccgc cctcgccggg gacggcgggc tgcagcgccc cggcggcggc       240
     tggctcagcc gcaccagcgc cgaggacgcc gccgtgcgct atggcgacct caccgtgatc       300
     atgctgaggt cccggctggt ctccctgctc agcggcctgc tggagacgga cgatctgcac       360
     ctgggcgtca ccgtcgagtc ggtctccccc gacgacggca ccgtgatcac cgaccggagg       420
     gccgaccgcg ccgacctgat cgtggccgcc gacgggatcg gctcccgcac ccgggccgcc       480
     cttttccccg gccaccccgg gccgcgctac ttcgggctga ccgcctggcg gctgctgacc       540
     gccgaccccg ggacgatcga ggcgttctcc gagacctggg gccgcggcct gctgttcggc       600
     gtcaccccgc tggccgacgg catgctgtac tgctacgccg ccgcacccgc ccccgccggg       660
     cggcgcgccc cggacgaaaa gcgggaactg ctgcggctgt tcgggacctg gcacgacccg       720
     atccccggcc tgctggccca agccgacccg gcgcggatcc tgcgcaacga catctacttc       780
     atggagcctc ccctgccggc cttccaccgg ggccgcgtcg tcctgctcgg ggacgccgcc       840
     caccccatga ccccccacct cgggcagggc gcctgccagg ccatcgagga cgcgatcgtg       900
     ctggcccacg aggtcaccga cggcggcggc ccggccgcct acaccgcggc ccgcctgccc       960
     cgcaccaccg agatcatgcg ccgttcccgg cggatcggac gcctggccgc gctgcagaac      1020
     ccgctcctgg tggccctgcg ggatgcggcc atgtggaccg ccaaccggct gggcccctcc      1080
     ctggtgctgc gccagggcga cccggttttc gcctggcgtc ccccggccgc ggcggcgggc      1140
     ctcatccggc ggtag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page