(data stored in ACNUC30630 zone)

EMBL: CP001738.PE182

CP001738.PE182       Location/Qualifiers
FT   CDS_pept        207332..208171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0186"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   reh:H16_A3310 ABC-type transporter, periplasmic component:
FT                   PAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95791"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEH5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACY95791.1"
FT                   /translation="MRSSRIAGRRAAAAASAVLAAVALAGCDAGGAGSILDKSTLRIGV
FT                   KADQPGLGLKRPDGTFEGFDVDVARYVAGRLGFAEEDITFVETPSSVREQALQERRVDM
FT                   IVATYSITAGRKTKVTFAGPYYVAHQDTLVRAGDGAVRNVRDLSGRRLCKVTGSNSWRR
FT                   VTEERKVPARLVETSSYSDCVNRLLSGELDAVSTDDLILAGFAARYGDRVKIINAPISD
FT                   EKYGIGLHKSDIDGCEAINTALTQMYQDGTARRLLDKWFGRTSLRTNPYVPQFEGCG"
     atgcgttcgt cccgcatcgc cggccgtagg gcggccgccg cggcatcggc cgtcctggcg        60
     gccgtcgcgc tcgccggctg cgacgccggc ggggccggct cgatcctgga caagtccacc       120
     ttgcggatcg gggtgaaggc cgaccagccc gggctgggcc tcaaacggcc ggacggcacg       180
     ttcgagggct tcgatgtgga cgtggccagg tacgtggccg gcaggctggg gttcgccgaa       240
     gaggacatca ccttcgtcga gacgccctcc agcgtccggg agcaggccct gcaggagcgg       300
     cgggtggaca tgatcgtggc gacctactcg atcaccgccg gccgcaagac caaggtgacc       360
     ttcgccgggc cgtactacgt cgcccaccag gacaccttgg tgcgggccgg cgacggcgcc       420
     gtcaggaacg tgcgcgacct gagcggccgc aggctgtgca aggtcaccgg ctccaactcc       480
     tggcggcggg tgaccgagga gcgcaaggtc ccggcacggc tggtggagac ctcctcctac       540
     agcgactgcg tgaaccggct gctgtcgggc gagctggacg cggtctcgac cgacgatctg       600
     atcctggccg ggttcgccgc ccggtacggg gacagggtca agatcatcaa tgccccgatc       660
     tcggacgaaa agtacgggat cgggctgcat aagagcgata tcgacgggtg tgaggcgatc       720
     aacaccgcgt tgacccagat gtaccaggac ggcaccgccc ggaggttgct ggacaagtgg       780
     ttcggccgca ccagcctgcg gaccaacccg tatgtgccgc agttcgaagg gtgcggctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page