(data stored in ACNUC30630 zone)

EMBL: CP001738.PE188

CP001738.PE188       Location/Qualifiers
FT   CDS_pept        complement(213869..215221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0192"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95797"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95797.1"
FT                   /translation="MSASRSTGSTPDLTIGVVGPHDLVERVMLMGNHSSTPIPSRLVAA
FT                   AYRDEQEAADKVLRLGSAVDVCLFASPVPYDFARKAGVLTMPATYVPLNGAALQGALLQ
FT                   AALDDRYDPAKVSIDVLTRSDVEEAYSEINLGIENVHLREEAAGPGTLAAFHERLWRRG
FT                   ITTVAMTCVHATAERMEMAGVPTIRVRPTGAAIRSSLQTAALLGAHHRLEESQLVVIVV
FT                   DVPTLRETPRRVTPRYWREELKLALHRTLVQEAHRMNASVWPVDDHSYLVTATRGSVSA
FT                   VTEGFRTPPFVDRVREELGVAIEVGIGMGRTAHEAETHARAALARSQTSQRAQGFALDR
FT                   DGRALVPAPRTPPRTQPQPKPKGLEILARLADKIDAENGGRNGDSQPLIVDAENAGRML
FT                   GVTPRTARRLLRTLVEEGLAWPLPPNRTPQPGRPRQLYRLIVEKLGPKATT"
     atgagcgcgt cgagatcgac cggttcgaca ccggacttga ccatcggtgt ggtcggcccg        60
     catgacttgg tggaacgcgt catgctcatg ggcaaccaca gctccacgcc gatccccagc       120
     aggctggtcg ccgcggccta ccgggacgag caggaggccg ccgacaaggt cctgcggctg       180
     gggtcggccg tggacgtgtg cctgttcgcc agtccggtgc cctacgactt cgcgcgcaag       240
     gccggggtgc tgaccatgcc ggccacctac gtgccgctga acggggcggc gctgcagggc       300
     gcgctgctgc aggcggccct ggacgaccgc tacgaccccg ccaaggtcag catcgacgtg       360
     ctcacccgtt ccgacgtcga ggaggcctat agcgagatca acctgggcat agagaacgtc       420
     cacctgcgcg aggaggccgc cggccccggc acgctggccg ccttccacga gcggctgtgg       480
     cggcgcggca tcaccaccgt ggcgatgacc tgcgtgcacg ccaccgccga gcggatggag       540
     atggcgggcg tgccgacgat ccgggtgcgc cccacgggcg cggcgatccg cagctccctg       600
     cagaccgccg cgctgctggg cgcccaccac cggctggagg agtcccagct ggtggtgatc       660
     gtggtggacg tccccacgct gcgcgagacg ccgcggcggg tcaccccgcg ctactggcgg       720
     gaggagctga agctggcgtt gcaccgcacc ctggtgcagg aggcgcaccg gatgaacgcc       780
     tcggtctggc cggtggacga ccacagctac ctggtcaccg ccacccgggg ctcggtctcc       840
     gccgtcaccg agggcttccg cactcccccg ttcgtggacc gggtccgcga ggagctcggg       900
     gtggccatcg aggtcggcat cggcatgggc cgcaccgcgc acgaggccga gacccacgcc       960
     cgtgcggcac tggcccgctc gcagacctcc cagcgggccc agggcttcgc cctcgaccgc      1020
     gacggccggg ccctggtccc cgcgccgcgc accccgccgc gcacgcagcc gcagcccaag      1080
     ccgaaggggc tggagatcct cgcccgcctg gccgacaaga tcgacgccga gaacggcggg      1140
     cgcaacggcg acagccagcc cctcatcgtg gacgccgaga acgccggccg gatgctgggg      1200
     gtcacccccc gcaccgcccg ccggctgctg cgcaccctgg tggaggaggg cctggcctgg      1260
     ccgctgcctc ccaaccggac cccgcagccg ggccgtcccc gccagctcta ccggctgatc      1320
     gtggagaaac tcggccccaa ggccaccacc tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page