(data stored in ACNUC30630 zone)

EMBL: CP001738.PE196

CP001738.PE196       Location/Qualifiers
FT   CDS_pept        complement(224748..226160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0200"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   bam:Bamb_6316 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95805"
FT                   /db_xref="GOA:D1AEI9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEI9"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACY95805.1"
FT                   /translation="MQDHWVNSGSDLHLELTGDGTVRERLMRALREAIRSGRLAPGTRL
FT                   PPYRSLAGDLGVAPNTVGAAYAELVAEGWLVARQGSGTRVAPRALPPPARRPRRTVPAR
FT                   RRPVHDLRPSSPDASAFPRTEWLRSARRALNAAPAEAFGVGDPRGRIELRTALAEYLAR
FT                   ARGVRTTPDRIIVCAGFAHALRLLGEVLEGPVAVEAYGLGFHRSLLTGAGLDTPPLRID
FT                   EGGARIDELPGTGARAVLLTPAHQYPTGGPLHPERRAAVIDWASATGGLVLEDDYDGEF
FT                   RYDRQPVGAVQGLDPDRVVYLGSVSKSLSPSLRLGWMVVPAHLTDELLRVKGERELWSG
FT                   VVDQLTLADFIACGGYDRHVRRMRQVYRRRRDRLVAALAERAPHITVSGIAAGLHAVLA
FT                   LPPGTEEDTVRAARRHGVAVDGLGDYRHPAGVMPPRDGLVVGYGTPPEHGFAAAVDALV
FT                   RALPPARTGYGK"
     atgcaagatc attgggtcaa ttccgggagc gacctccacc tggagctgac cggggacggc        60
     accgtgcggg aacggctgat gcgggcgctg cgcgaggcga tccgctccgg ccggctcgcc       120
     cccggcaccc ggctgccgcc gtaccggagc ctggccggcg acctgggcgt cgcgcccaac       180
     accgtcggcg cggcctatgc cgagctggtc gccgagggct ggctggtcgc ccggcagggc       240
     tcgggcaccc gggtcgcccc gcgcgccctg ccgccgccgg cccggcgccc gcgccgcacc       300
     gtgcccgccc ggcggcgccc cgtccacgac ctgcggccga gctccccgga cgcctcggcg       360
     ttcccccgca ccgagtggct gcgctcggcg cgccgggcgc tgaacgccgc acccgccgag       420
     gcgttcgggg tcggggaccc gcgcgggcgg atcgagctgc ggaccgccct cgccgaatac       480
     ctggcccggg cccgcggggt ccgcaccacg ccggaccgga tcatcgtctg cgccgggttc       540
     gcgcacgcgc tgcgcctgct gggcgaggtg ctggagggcc cggtggcggt ggaggcctac       600
     gggctgggct ttcaccgctc gctgctgacc ggggcgggac tggacacgcc gccgctgcgg       660
     atcgacgagg gcggcgcccg gatcgacgag ctgcccggca cgggggcgcg ggccgtgctg       720
     ctcaccccgg cgcaccagta cccgaccggc gggccgctgc atcccgagcg ccgcgccgcc       780
     gtcatcgact gggcgtccgc caccgggggg ctggtgctgg aggacgacta cgacggcgag       840
     ttccgctacg accgccagcc ggtcggtgcc gtgcagggcc tggatccgga ccgggtggtc       900
     tatctgggct cggtcagcaa gagcctgtcg ccctcgctgc gtctgggctg gatggtcgtg       960
     cccgcccatc tgacggacga gctgctgcgg gtcaaggggg agcgcgagct gtggtcgggg      1020
     gtggtggacc agctcaccct ggcggacttc atcgcctgcg gcggctacga ccggcacgtg      1080
     cgccggatgc ggcaggtcta ccggcgccgc cgcgaccggc tggtggccgc cctcgccgaa      1140
     cgcgccccgc acatcaccgt cagcggtatc gccgcgggcc tgcacgccgt gctcgccctg      1200
     ccgcccggca ccgaggagga caccgtgcgg gccgcccggc ggcacggcgt ggccgtcgac      1260
     gggctcggcg actaccggca tccggcgggc gtcatgccgc cccgggacgg gctggtggtg      1320
     gggtacggca cgccgcccga gcacgggttc gcggcggcgg tggacgctct ggtgcgggcg      1380
     ctgccgcccg ccagaaccgg ctacggaaag taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page