(data stored in ACNUC30630 zone)

EMBL: CP001738.PE21

CP001738.PE21        Location/Qualifiers
FT   CDS_pept        25433..26596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0022"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95630"
FT                   /db_xref="GOA:D1ADC0"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADC0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACY95630.1"
FT                   /translation="MRRPGAGDESRLRTVVLAAGVVVGTAGLAAGSLYAVQAGEPAERP
FT                   AGTADAALTGAGGTPGEAVRAEPATADRAGADVLAARLARRLGDRTAGAYLDDAGRPVV
FT                   TVTNAADAAMVRRAGAVPKPVPRSPATLNRITGTLRRSVGSIPGTGWAIDPAAGQVVMW
FT                   TDDTVTGARMASVRRAARQMGPAVRMVRIPGRLRTFALGGDAIFGQGARCSLGFNVRRG
FT                   RQNFFLTAGHCGNVVRTWTADRRGAQVLGTTVRSSFPGNDFALVRSAPGAAGQGAVNLY
FT                   NGRAQDIVRAADPVVGQRVVRSGSTTGVSTGRVTAVNATVNFPEGTVTGMIQTTVCAEP
FT                   GDSGGPLFSGTTALGLTSGGAGDCRIGGVTFFQPVTEALRAFGVEVF"
     atgaggcgtc cgggtgcagg tgatgagagc cgtctgcgca ccgtggttct cgccgccgga        60
     gtggtcgtcg ggaccgccgg gctggcggcc ggatcgctgt atgcggtgca ggccggggaa       120
     ccggccgaac gccctgcggg aacggcggac gccgcgctga cgggagccgg cggcaccccg       180
     ggcgaggcgg tgcgggcgga accggccacg gcggaccggg ccggcgccga cgtcctggcc       240
     gcccggctgg cccggcggct cggcgaccgc acggccgggg cctacctcga cgacgccggc       300
     cgcccggtcg tcacggtcac caacgccgcg gacgccgcca tggtccgccg ggcgggcgcg       360
     gtgccgaagc cggtgccccg cagccccgcc acgctgaaca ggatcaccgg caccctgcgg       420
     cgctcggtgg ggagcatccc cggcaccggg tgggccatcg accccgccgc cggccaggtg       480
     gtgatgtgga cggacgacac ggtcaccggg gcgcggatgg cgagcgtccg ccgggcggcg       540
     cggcagatgg gcccggcggt gcggatggtg cgcatccccg gccggctgcg cacgttcgcg       600
     ctcggcggcg acgccatttt cgggcagggc gcgcgctgct cgctgggctt caacgtccgc       660
     cgcggtcggc agaacttctt cctgaccgcc gggcactgcg gcaacgtggt ccgcacctgg       720
     accgccgacc ggcggggcgc ccaggtgctg ggcaccacgg tgcgcagcag cttccccggc       780
     aacgacttcg cgctcgtgcg ctccgccccg ggcgccgccg ggcagggcgc ggtcaacctc       840
     tacaacggcc gggcgcagga catcgtccgg gccgcagacc ccgtggtggg ccagcgggtg       900
     gtgcgcagtg gaagcaccac cggggtcagc accggccggg tcaccgccgt caacgccacg       960
     gtgaacttcc ccgagggaac cgtcaccggc atgatccaga ccaccgtctg cgccgagccg      1020
     ggcgacagcg gcggcccgct gttcagtggc accaccgcgc tgggcctgac ctccggcggc      1080
     gcgggcgact gccggatcgg cggcgtcacc ttcttccagc cggtgaccga ggcgctgcgc      1140
     gccttcggcg tcgaggtctt ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page