(data stored in ACNUC30630 zone)

EMBL: CP001738.PE212

CP001738.PE212       Location/Qualifiers
FT   CDS_pept        complement(237178..239616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0216"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: scl:sce3351
FT                   putative beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95821"
FT                   /db_xref="GOA:D1AEK5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK5"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACY95821.1"
FT                   /translation="MASANTREHAPEGVVITGLAVVCALGSQTEQVWRAVRDGECGVRP
FT                   TRHIDVSTLTCRYSAEMVQLPRSGPQRRDRATTMTLQVGQAAIESAGLHPRQLDPYRFG
FT                   VAIGTSVGGLESGERFHAELIHRGLEETDRTHLLSYPLYTSADELSTAFGAKGPKVVIS
FT                   NACAAGANAIGYAADALRLGRADVMLAGGVDPIDILSLAGFDSLKALDSQPCAPYSRSG
FT                   GLSLGEGAAILVLETESHAAARGATVLGHVLSYALTSDAHHATAPDPGGEGARRAMAGA
FT                   LAEAACGPEEVDYVSGHGTGTPANDSAELRAFGNLFPDPQRPPVSSTKSQVGHTLGAAG
FT                   AIEAAMCVLALRDQVLPPTVNVAPDRTPARDIVPGRGRPHRIETVLSNSFAFGGNNCSI
FT                   LLGRRPGPRRRPAPRRVVVTGAGVVSPLGTGRAEFLRALREGAVAVRPAERLDIGGARS
FT                   RLAAELPDERHRRLVDRSYARRLDQLGLLTLAATRLALQDAGYQVSRAESERVGMIFGT
FT                   GTGPMETVAALSETIIKEGPHRVNPRLFPNSVMNAAAGHACLAFQIKGPLSTVATGCAA
FT                   GLTAVGYAADLIRQGRADVMIAVAADELTPLLHLGFDRLGLLTETQVRPYDRRRSGMAL
FT                   GAGAVAVVLESAEHAERRKAAIAAEFGGHAITADAHRVAGNDPTGAALAECMTRALADA
FT                   GIPPERVGGVYGDARGVRSIDLLEARAIGRVLPWAQVACLSGQSGHINATTPLLSLVSA
FT                   LESCRSGWLPPIRGLCEPLPVPALRTSVPAGAARRDAYLVNAIGWGGTYASAVLTAWDG
FT                   "
     atggcatcgg cgaacactcg ggaacacgcc cccgaaggcg tcgtcatcac gggcctggcg        60
     gtggtgtgcg cgctgggttc ccagaccgag caggtgtggc gcgcggtccg cgacggagag       120
     tgcggcgtgc gccccacccg gcacatcgac gtgtccaccc tgacctgccg ctactcggcc       180
     gagatggtgc aactgccaag atcggggccg cagcggcggg accgggccac cacgatgacg       240
     ctgcaggtcg ggcaggccgc gatcgagtcg gccggactgc acccccggca gctggacccc       300
     taccgcttcg gcgtggccat cggcacctcg gtcggcgggc tggagtccgg cgagcggttc       360
     cacgccgagc tcatccaccg cggcctggag gagaccgacc gcacccacct gctgtcctat       420
     ccgctgtaca cctcggcgga cgagctgagc accgccttcg gcgccaaagg accgaaggtc       480
     gtcatctcca acgcctgcgc ggcgggcgcg aacgccatcg gttacgcggc cgacgcgctg       540
     cggctgggcc gggccgacgt catgctcgcc ggcggcgtgg accccatcga catcctgtcg       600
     ctggccgggt tcgacagcct caaggccctg gactcccagc cgtgcgcccc ctactcccgc       660
     agcggcgggc tcagcctggg agagggcgcg gcgatcctgg tgctggagac cgagtcgcac       720
     gccgcggcgc gcggcgccac cgtgctcggg cacgtgctgt cgtacgcgct gaccagcgac       780
     gcccaccacg ccaccgcccc cgacccgggc ggcgaggggg cccgccgcgc catggcgggg       840
     gcgctggccg aggcggcgtg cgggccggag gaggtggact acgtcagcgg gcacggcacc       900
     ggaacccccg ccaacgacag cgcggagctg cgggccttcg gcaacctgtt ccccgacccg       960
     cagcgtcccc cggtcagcag caccaagtcg caggtggggc acacgctcgg cgcggccggg      1020
     gcgatcgagg cggcgatgtg cgtgctggcg ctgcgcgacc aggtgctgcc cccgacggtc      1080
     aacgtcgcgc ccgaccgcac ccccgcccgc gacatcgtcc ccggccgggg ccgcccgcac      1140
     cgcatcgaga cggtgctgtc gaactccttc gccttcggcg gcaacaactg ctcgatcctg      1200
     ctcggccgcc gccccggccc ccgacgccgc ccggccccgc gccgggtcgt ggtgaccggt      1260
     gccggcgtgg tctccccgct gggcaccggc agggccgagt tcctgcgcgc gctccgggag      1320
     ggggcggtgg ccgtccgtcc cgcggaacgg ctggacatcg gcggggcccg cagccggctg      1380
     gcggccgagc tgcccgacga gcggcaccgg cggctggtgg accgttctta tgcccgccgg      1440
     ctcgaccagc tcggcctgct gacgctggcc gccacccggc tggcgctgca ggacgccggc      1500
     taccaggtct cccgggccga aagcgaacgc gtcggcatga tcttcggcac cgggaccggg      1560
     ccgatggaga cggtggccgc gctcagcgag acgatcatca aggaggggcc gcaccgggtc      1620
     aacccgcggc tgttccccaa ctcggtgatg aacgccgccg ccgggcacgc ctgcctggcc      1680
     ttccagatca agggcccgct gtcgaccgtg gcgaccggct gcgcggcggg gctgacggcc      1740
     gtcgggtacg ccgccgacct catccgccag ggccgggcgg acgtgatgat cgccgtcgcc      1800
     gccgacgagc tgaccccgct gctgcacctg ggcttcgacc ggctcggcct gctcaccgag      1860
     acccaggtgc ggccgtatga ccggcggcgc tcggggatgg cgctgggcgc cggcgcggtc      1920
     gccgtggtgc tggagtccgc cgagcacgcg gagcggcgca aggcggcgat cgcggccgag      1980
     ttcggcggac acgccatcac cgccgacgcc caccgggtgg ccggcaacga tcccaccggg      2040
     gcggcgctgg cggaatgcat gacgcgggcg ctggccgacg ccggcattcc ccccgagcgg      2100
     gtcggcggcg tgtacggcga cgcccgcggc gtccgctcca tcgatctgct ggaggccagg      2160
     gccatcggcc gggtgctgcc ctgggcgcag gtggcctgcc tgagcgggca gagcgggcac      2220
     atcaacgcca ccactccgct gctgtcgctg gtcagcgcgc tggagagctg ccgttcgggc      2280
     tggctgccgc cgatccgggg gctctgtgaa ccgctgcccg tgccggccct gcgcacgtcc      2340
     gtccccgccg gcgcggcacg gcgggacgcc tatctggtca acgccatcgg ctggggcggg      2400
     acctacgcct cggcggtgct caccgcctgg gacgggtga                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page