(data stored in ACNUC30630 zone)

EMBL: CP001738.PE215

CP001738.PE215       Location/Qualifiers
FT   CDS_pept        complement(241340..241627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0219"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   mxa:MXAN_6392 putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95824"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D1AEK8"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACY95824.1"
FT                   /translation="MPMTLAEARSRAARRQELCSAVKKLIVDRLDLDVDPALIGDDQPL
FT                   FGRGLELDSIDTLELAVSIQEEFDVVIDDDDRESLMSINRLVDHLEANLP"
     atgcccatga ccctcgccga ggcccgcagc cgggcggccc gccgccagga gctgtgcagc        60
     gccgtcaaga aactgatcgt cgaccggctc gacctggacg tggacccggc gctgatcggc       120
     gacgaccagc ccctgttcgg ccgggggctg gaactggact ccatcgacac cctggagctg       180
     gccgtctcca tccaggagga gttcgacgtc gtgatcgacg acgacgaccg ggagagcctg       240
     atgtccatca accgcctggt ggaccacctg gaggcgaacc tgccgtga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page