(data stored in ACNUC30630 zone)

EMBL: CP001738.PE237

CP001738.PE237       Location/Qualifiers
FT   CDS_pept        complement(266283..266999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95846"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1C4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95846.1"
FT                   /translation="MKRPLRRLTVLASATAAALAALISPPAASAAQAADEFADCPSLPA
FT                   DARPLTWKCYVLTAEDTLIGVSLGRMHAHTKEPIRLTVAQGSLTNGKTVAKLGALRANP
FT                   IPFVTGVPGTPFEVPHPTGWKLEITPTGMIEPGILVPHKLGVTARIIGDGLGDSCRVGS
FT                   SSRPIVIDPVVNWALPWVSNGKVGTRMKVADIVYSLPIATGCNGKDFTVNQLLGLPANS
FT                   VSNQFQVTWTMISKRY"
     gtgaaacgac cactgcgccg actgaccgtc ctggcgtccg ccaccgccgc cgccctggcg        60
     gccctgatct ccccgcccgc cgcctcggcc gcccaggccg ccgacgagtt cgccgactgc       120
     ccgtcgctgc ccgccgacgc ccggccgctc acctggaagt gctacgtgct gaccgccgag       180
     gacaccctga tcggcgtcag cctcggccgc atgcacgccc acaccaagga gccgatccgg       240
     ctgaccgtcg cccagggcag cctcaccaac ggcaagaccg tcgccaagct cggcgcgctg       300
     cgcgccaacc ccatcccgtt cgtcaccggg gtccccggca cccccttcga ggtcccccac       360
     cccacgggct ggaagctgga gatcaccccg accgggatga tcgagcccgg catcctggtc       420
     ccgcacaagc tcggggtgac cgcccgcatc atcggcgacg gcctgggcga ctcctgccgg       480
     gtcggctcct cctcccgccc gatcgtcatc gacccggtgg tcaactgggc gctgccgtgg       540
     gtcagcaacg gcaaggtcgg cacccgcatg aaggtggccg acatcgtcta ctcgctgccc       600
     atcgccaccg gctgcaacgg caaggacttc accgtcaacc agctgctggg gctgcccgcc       660
     aactccgtca gcaaccagtt ccaggtcacc tggacgatga tcagcaagcg ctactga          717
//

If you have problems or comments...

PBIL Back to PBIL home page