(data stored in ACNUC30630 zone)

EMBL: CP001738.PE256

CP001738.PE256       Location/Qualifiers
FT   CDS_pept        complement(288106..289740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0261"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: mno:Mnod_4215 CHAD domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95865"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E3"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="ACY95865.1"
FT                   /translation="MADPKSQLEVERKYDADRDFTLPDLSGLPGVASVSEPRTHVLIAN
FT                   YFDTCDHRLAARGITLRRRRGGADAGWHLKIPVAPDSKNELRASLGRPQVVPAKLARLV
FT                   AVHVRGAQLRPVAVLETERTVILLRDAGGRLLAEVADDTVTGRLIDSEGAEQPGTTVWR
FT                   EIEIELGPAGTPELLRAAGERLQQAGARPASGPAKLGRVLEPVMAVPFGGHRRALPDLP
FT                   AGSAGAAVIGYLAKQVDAVISYDPKARLAEFDAVHKMRVAVRRIRSALRSYAPLLDPVR
FT                   IAPLEPELRWLAEVLGEVRDLEVLRMRFTDRLERPYGLHPAASQSWLEALSKREKSAYR
FT                   RMNTTLTQPRYFALLDALDALVADPPLSERAFRPAVAELPRLVTRQWRRLTRKYEAIAT
FT                   AKDPEEARHDARKAAKRARYAAELAAAALRELKPQAADGARPAKGKGKKRKASRRAAAE
FT                   PARSPAELAEIAAQTAAHAKRLQEVLGGYQDGVIAMQHLRAAAAERSTTPAEAFVLGVL
FT                   YGIERCEALESLSRVEATWEQTAPPAF"
     gtggccgacc cgaaaagcca gcttgaggta gaacgcaaat acgacgccga ccgcgacttc        60
     acactgccgg atctatccgg tctgcccggg gtcgcgtccg tgagcgaacc ccgcacgcat       120
     gtgctcatcg cgaactactt cgacacctgt gaccaccggc tggccgcccg cggcatcacc       180
     ctgcgccggc ggcgcggcgg ggcggacgcc ggctggcacc tgaagatacc ggtggccccc       240
     gacagcaaga acgagctgcg cgcctcgctc ggccgccccc aggtcgtccc ggcgaagctg       300
     gcccggctgg tggccgtcca tgtccggggg gcacagctgc ggccggtggc ggtgctggag       360
     accgaacgca ccgtgatcct gctgcgggac gcaggcgggc ggctgctggc ggaggtcgcc       420
     gacgacacgg tgaccggacg gctcatcgac tccgaaggcg ccgagcagcc gggcaccacc       480
     gtctggcggg agatcgagat cgagctgggc ccggccggca ctcccgagct gctgcgggcg       540
     gccggggagc ggctgcagca ggccggggcc cgcccggcga gcggcccggc caagctgggg       600
     agggtgctgg agccggtcat ggcggtcccg ttcggcgggc accgccgcgc gctgccggac       660
     ctgccggccg gttcggccgg cgccgcggtg atcggctacc tggccaagca ggtggacgcg       720
     gtgatctcct acgaccccaa ggcccggctg gcggagttcg acgcggtgca caagatgcgg       780
     gtggccgtcc gccggatccg cagcgcgctg cgcagctacg cgccgctgct ggacccggtg       840
     cgcatcgccc cgctggaacc ggagctgcgg tggctggcgg aggtcctcgg cgaggtgcgc       900
     gacctggaag tgctgcggat gcgcttcacc gaccggctgg agcggcccta cgggctgcac       960
     ccggccgcct cccagtcgtg gctggaggcg ctgagcaagc gggagaagtc ggcctaccgc      1020
     aggatgaaca ccaccctcac ccagccgcgc tacttcgccc tgctggacgc gctggacgcg      1080
     ctggtggccg acccgccgct gagcgagcgg gcgttccggc cggcggtcgc cgagctgccc      1140
     cggctggtca cccgccagtg gcggcggctg acccgcaagt acgaggcgat cgccaccgcc      1200
     aaggaccccg aagaggccag gcatgacgcc cgcaaggccg ccaaacgcgc ccgctatgcg      1260
     gccgagctgg ccgccgccgc gctgcgcgag ctgaagccgc aggccgccga cggcgcccgc      1320
     ccggccaagg gcaagggcaa aaagcgcaag gcgtcccgca gggccgccgc cgagccggcc      1380
     cggtcaccgg cggagctggc cgagatcgcc gcgcagaccg ccgcccacgc caaacgcctc      1440
     caggaggtcc tgggcggcta ccaggacggc gtcatcgcga tgcagcacct gcgggccgcc      1500
     gcggccgaac gctccaccac cccggccgag gcgttcgtgc tgggcgtcct ctacggcatc      1560
     gaacgctgcg aggccctgga atccctgtcc cgcgtggagg ccacctggga gcagaccgcc      1620
     ccgccggcct tctga                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page