(data stored in ACNUC30630 zone)

EMBL: CP001738.PE259

CP001738.PE259       Location/Qualifiers
FT   CDS_pept        complement(291673..292908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_2920 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95868"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95868.1"
FT                   /translation="MSTADDPRAIAARLRAEREKRGWGQRKTARFLRDATDDHQKPDLS
FT                   SFVTYVKRWESGEVRPCDPRYRAAYAKVFGVSEDELFGPRPQPSSSRPPEPHDDPDERE
FT                   RLALAARNPARLDEAVVDGLAATLAHQRRLEDSTGSGRMLAPAAEHLKLILRLLKEARA
FT                   APAARLAQTAAEASQFVGWLHTAVGAYEDASTLYDQALRLGMQSRNTDLAATALSMQGH
FT                   LAWVTGDIGAMAELSKAAAEMATATGTRAMAVQQSGRALAVLGDRQGALRSIGEAEEIL
FT                   AGGTRADDPDGLYFYGPAYLTMQRGLILSYLAEDPAQHGAAAGLIASGIQALAADVRNS
FT                   EWVAWYRVRAAAAHARGGDITEAVTGLRTALGIVTGTGGGRTRAELVKTHRALIRRWPR
FT                   HPGLAELGEALR"
     atgagcaccg ccgacgaccc ccgcgccatc gccgcacgcc tgcgagccga acgcgaaaag        60
     cgcggctggg ggcagcggaa gacggcccgt ttcctgcgag acgccaccga tgatcaccaa       120
     aagcccgacc tctcttcgtt tgtgacttat gtcaaacgct gggagagcgg cgaagtccgg       180
     ccatgcgatc cccgctaccg ggccgcttac gccaaagtgt tcggcgtctc ggaagacgag       240
     ttgttcggcc cccgcccaca gccctcctca tcgcgcccgc cggaaccgca tgacgatccg       300
     gacgaacgtg agcggctggc cctcgccgcg cgcaatcccg cccggctgga tgaggccgtg       360
     gtggacgggc tggccgccac cctcgcccat cagcggcgcc tggaagactc gaccggttcc       420
     ggccgcatgc tggcgcccgc ggccgagcac ctgaaattga tcctgcggct gctgaaagag       480
     gcccgtgccg ctccggccgc ccggctcgcc cagacggccg ccgaggcctc ccaattcgtc       540
     ggatggctgc acaccgccgt cggcgcctac gaggacgcga gcacgctata cgaccaggca       600
     ctgagactcg gcatgcaaag ccgcaacacc gacctcgccg cgacggcatt gtccatgcaa       660
     gggcatctgg cgtgggtgac cggcgacatc ggtgccatgg ccgagttgtc gaaggccgcc       720
     gccgagatgg ccaccgcgac cggcacccgt gccatggccg tccagcagag cggacgggcg       780
     ctggccgttc tgggggatcg gcagggggcg ctgaggagca tcggcgaagc cgaagagatc       840
     ctggccggcg gcacccgcgc agacgacccg gacggcctct acttctacgg cccggcgtac       900
     ctgaccatgc aacgcggact gatcctgtcc tacctcgccg aggacccggc acagcacggc       960
     gccgccgccg gtctcatcgc ctcgggcatc caggcgctcg ccgcggacgt gcggaactca      1020
     gagtgggtgg cctggtaccg cgtgcgggcc gcggccgctc acgcccgcgg cggcgacatc      1080
     accgaggcgg tcaccggcct gcgcaccgcg ctcggcatcg tgaccggcac cggcggcggc      1140
     cggacccgcg ccgagctggt caaaacgcac cgggcgctaa tccggcgctg gccgcggcac      1200
     cccggcctcg ccgaactcgg cgaggcactg cgctga                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page