(data stored in ACNUC30630 zone)

EMBL: CP001738.PE262

CP001738.PE262       Location/Qualifiers
FT   CDS_pept        294300..294974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0267"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: dat:HRM2_28470
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95871"
FT                   /db_xref="GOA:D1A1E9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1E9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACY95871.1"
FT                   /translation="MGTFIRAGALSQQRDPYGGCQMNDPLVPRRSRSEGLATHAARAVS
FT                   AAVLVGTVTAVMWVLEALDYALGGALDRYGIRSYDLGELPDIFTAPFLHGGFGHLMANT
FT                   MPFLVLGFLAAVRGIGRFLAASLIIIVVGGLGVWFTGSPSVETLGSSILIFGYFGYLLS
FT                   RGLFERSLLDLAIAVVVVLSYGTMIYGILPTHPMISWQGHLFGLIGGVLAAWVLRRRDA
FT                   WS"
     atgggcacct ttataagggc cggagcgttg tctcaacagc gcgaccccta tggaggctgc        60
     cagatgaacg accccctcgt cccgcggcgg agccgttcgg aagggctggc gacgcacgcc       120
     gcccgcgcgg tctcggcggc cgtgctggtg ggaacggtca ccgcggtcat gtgggtgctg       180
     gaggcgctgg actacgcgct gggcggtgcg ctcgaccgct atggcatccg gtcctatgac       240
     ctcggtgaac tgccggacat cttcaccgcg ccctttctgc acggcgggtt cgggcatctg       300
     atggccaaca cgatgccgtt cctggtgctg ggctttctgg cggcggtgcg cgggatcggc       360
     cggttcctgg cggccagcct gatcatcatc gtggtgggcg ggctgggcgt gtggttcacc       420
     ggctcgccct cggtggagac cctgggcagc agcatcctga tcttcggcta cttcggctac       480
     ctgctgagcc ggggcctgtt cgaacgcagc ctgctggacc tggcgatcgc cgtcgtggtg       540
     gtgctgagct acggcacgat gatctacggc atcctgccca cccacccgat gatctcctgg       600
     cagggccacc tgttcgggct gatcggcggc gtcctggccg cctgggtact gcgccgccgc       660
     gacgcctgga gctag                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page