(data stored in ACNUC30630 zone)

EMBL: CP001738.PE270

CP001738.PE270       Location/Qualifiers
FT   CDS_pept        complement(302747..303610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGP9; AGP9 (ARABINOGALACTAN PROTEIN 9)"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95879"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95879.1"
FT                   /translation="MVGNFRGTVFLEDGRITFAESPGIPDPAARLVGSGRLSEDQWPVP
FT                   RENPARDTGALLLERGLLGEEELRAVLHSVVLDVLIALLADRSPAADVRFAPLERHWAG
FT                   RLLALNPGAALAEAERRSALPAVRRVSPRARPKACELLRPWAVLRREHWPLLQRADGVR
FT                   TVRDLAWHSGLALHDTIESVDALAHAGLCVLLPPVPHPDVPEPAARPPGQTAPPPRPAL
FT                   PAPPSSAAPAADPPLPHRVRGASAPPGADALLAAAPRVHDDEQPVFTAHPDVLRRVLEG
FT                   LKRLGR"
     gtggttggaa atttccgggg aacggtcttc ttggaagacg ggcgcatcac cttcgcagaa        60
     tcgcccggca ttcccgatcc cgccgcccgg ctggtcggct ccggacgcct ttccgaggac       120
     caatggccgg tgccgcggga aaacccggcg cgcgataccg gcgcccttct gctggaacgg       180
     ggcctgctcg gcgaagagga gttgcgggcc gttttgcact cggtcgtcct ggatgtgctc       240
     atcgcgctgc tggccgaccg gtccccggcc gccgacgtcc gcttcgcgcc gctggaacgg       300
     cactgggccg gccggctgct cgccctgaac cccggcgcgg cgctggccga ggccgaacga       360
     cggtccgcgc tgcccgccgt ccgccgcgtc tccccccggg cccgccccaa agcgtgcgag       420
     ctgctccgcc cctgggccgt gctgcgccgg gagcactggc cgctgctgca gcgggccgac       480
     ggcgtgcgca ccgtccggga cctggcctgg cacagcgggc tggccctgca cgacaccatc       540
     gagtccgtgg acgccctggc ccacgcgggc ctgtgcgtgc tgctgccgcc cgttccccac       600
     ccggacgtcc ccgagcccgc cgcacggcct cccggccaga cggcgccccc gccgagaccg       660
     gccctcccgg caccgccgtc ttcggcagca ccggccgccg acccaccgct gccccaccgc       720
     gtgcggggag cgtcggcacc gcccggagcg gacgcgctcc tcgccgcggc gccccgcgtc       780
     cacgacgacg aacaaccggt cttcacggcg cacccggacg tgctccggcg cgtcctggaa       840
     gggctcaagc gcctgggcag gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page