(data stored in ACNUC30630 zone)

EMBL: CP001738.PE278

CP001738.PE278       Location/Qualifiers
FT   CDS_pept        complement(309953..310303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0283"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: afw:Anae109_0580 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95887"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1G5"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACY95887.1"
FT                   /translation="MRFLMMTTDDGSDQSPPSERLQAEMGAFIAEMSRAGVLLATGGLE
FT                   PGGVHITARDGEITVTDGPFSESKEAVAGFALVEVRSREEAIELSRRFWKIVGNGRGVI
FT                   KQVFGPEDLPGQ"
     atgcggttcc tgatgatgac caccgacgac ggttcggacc agagcccgcc cagcgagcgg        60
     ctgcaggccg agatgggcgc gttcatcgcc gagatgagca gggcgggcgt gctgctggcc       120
     accggcgggc tggagcccgg cggtgtccac atcaccgccc gggacggcga gatcaccgtg       180
     accgacgggc ccttcagcga gtccaaggag gcggtggccg gtttcgcgct ggtcgaggtg       240
     cgcagccggg aggaggccat cgagctgtcc aggcggttct ggaagatcgt cggcaacggc       300
     cgcggggtca tcaagcaggt cttcggcccg gaggacctgc ccggccagtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page