(data stored in ACNUC30630 zone)

EMBL: CP001738.PE286

CP001738.PE286       Location/Qualifiers
FT   CDS_pept        complement(318587..319828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to mucin"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95895"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95895.1"
FT                   /translation="MRDPELALCAQRAASELERAWSRWRRAHGLAGRPAESVASYVTHS
FT                   LDHPWGRPRVVLGLDAEEARALAALLGRLDPPQGRPQPPSTRPGAPSHPEGRAQAPFAP
FT                   VGAPLTRLAPPPSWAAVSAARTGAPAGPADVPSSQVDTLPNRIKDLLNGTHPPAERPQE
FT                   PDSQSGTTPTPNGAARPAFPPQNCVENPPNGTGAPAGQPDSPAPAEPPQNHTGKPLNGT
FT                   NTAAEQTQELRLPGALPNCADLPPNGTAAPLNGIVRPAGRPALAALPPGRADLMQNRAK
FT                   NPPNGTGAPAGRPDSPGRTEPPQNHTGKPLNGTNTPAEQAPDSPGRAAPPPSGATVLFG
FT                   GIVRPVERLACVDAPPSGPAERFIPVDLQVEPPQGPAVSSPGNGADAALGNTDRPTEWL
FT                   IQVGPPPGCAGSPQ"
     gtgcgtgatc cagagttggc gctgtgcgca cagcgcgcgg caagcgagct ggaacgtgcc        60
     tggtcacggt ggcggcgcgc gcacgggctg gccgggcgcc cggcggaatc ggtggccagt       120
     tacgtgacgc actcgctgga tcatccctgg ggccgtcccc gggtcgtctt gggcctggac       180
     gccgaggagg cccgtgcgct ggccgcgctg ctcggccgtc tcgacccgcc gcaaggccgc       240
     ccgcagccgc cgtcgacccg tccgggcgcc cccagccacc cggagggccg ggcgcaggcc       300
     ccgttcgccc cggtgggcgc gccgctgacg cgcctggctc ccccgccgag ctgggcggcc       360
     gtctccgccg cccgcaccgg cgcgccggcc gggcccgcgg atgtcccttc cagccaggtg       420
     gacaccctgc ccaaccgcat caaggacttg ctcaacggca cgcacccgcc cgcggaacgg       480
     ccgcaggaac cggactcgca aagcggtacg acgcccacgc ccaacggcgc cgcccggccc       540
     gccttcccgc cgcagaactg cgttgaaaac ccaccgaacg gcacgggcgc acccgcggga       600
     caaccggatt caccggcccc cgcagagccg ccgcaaaacc acaccggcaa accgctgaac       660
     ggcacgaaca cggccgcaga acagacccag gagctgcgcc ttccgggcgc cttgccgaac       720
     tgcgcggacc tgccgccgaa cggcacggcg gccccgctca acggcatcgt ccggcccgcc       780
     ggacggcccg ccctggccgc tctcccgccg ggccgcgcgg atttgatgca aaaccgcgcc       840
     aagaacccgc cgaacggcac gggcgcaccc gcgggacggc cggattcacc gggccgcaca       900
     gagccgccgc aaaaccacac cggcaaaccg ctgaacggca cgaacacgcc cgcagagcag       960
     gcaccggact cgccgggccg ggcggccccg ccgccgagcg gtgcgacggt cctgttcggc      1020
     ggcatcgtcc ggcccgtgga acggctcgcc tgcgtcgatg cgccgccgag cggccccgcc      1080
     gagcgattca tccccgtcga tctccaggtg gagccgccgc agggccccgc cgtgagctcg      1140
     ccgggcaacg gcgcggacgc cgcgctcggc aacaccgaca ggcccacgga atggctcatc      1200
     caagtcggcc cgccgccggg ctgcgcgggg tcaccgcagt ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page