(data stored in ACNUC30630 zone)

EMBL: CP001738.PE301

CP001738.PE301       Location/Qualifiers
FT   CDS_pept        complement(335614..335862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95910"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1I8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95910.1"
FT                   /translation="MHDHSGVVPVTRECPLVCLGLSRHAANPLRFHLGSRATVGQVLRL
FT                   WENDELQRVRGLGPRRIGEITTALVAAGFVLTPHGHR"
     gtgcatgatc acagcggggt ggttccggtg acgcgggagt gcccgctggt ctgcctgggc        60
     ctatcccggc atgcggccaa tccgttgcgg ttccatctgg ggagcagggc gacggtgggc       120
     caggtgctgc ggctgtggga aaacgacgaa ctccaacgcg tccgcggctt ggggccgcgg       180
     cggatcgggg aaatcaccac ggcattggtc gcagcggggt tcgtgctgac tccccacggt       240
     catcgctga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page