(data stored in ACNUC30630 zone)

EMBL: CP001738.PE305

CP001738.PE305       Location/Qualifiers
FT   CDS_pept        complement(338225..338893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0310"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: avn:Avin_47740 haloacid dehalogenase-like
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95914"
FT                   /db_xref="GOA:D1A1J2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J2"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACY95914.1"
FT                   /translation="MLDMIQAVVFDVGECLVNETREYGTWADWLGVPRHTFSAVFGAVI
FT                   ARGLDYRETFQVFVPGFDLTEQREKRAAVGQAEWFGEDDLYPDARPTLAALREAGLWVG
FT                   IAGNQTVRAGGILRELKLPCDMLATSDDWGVAKPDPAFFKAVVREAPCEAGEILYVGDR
FT                   LDNDIRPAVAVGLKTALIRRGPWGIIQQDDPDADRLPTMRIDSLTELPSRIAEFNASAR
FT                   "
     atgttagaca tgatccaggc tgttgtcttc gatgtgggcg agtgtctggt taatgagact        60
     cgggagtatg ggacctgggc ggactggctg ggggtgcctc ggcatacgtt ctcggcagtg       120
     ttcggggcgg tgatcgcccg ggggctggac tatcgggaga cgttccaggt gttcgtccct       180
     gggtttgacc tgactgagca gcgggagaag cgggcagcgg tggggcaggc cgagtggttt       240
     ggcgaggatg acctgtatcc ggatgcacgg ccgacgctgg ctgcgctgcg ggaggccggc       300
     ttgtgggtgg ggatcgcagg gaatcagacg gtgcgggcgg gaggcatcct gcgggaactg       360
     aagctgccgt gtgacatgtt ggccacctcc gatgactggg gggtggccaa gccggatccg       420
     gcgttcttca aagctgtggt gcgggaggcg ccgtgtgagg cgggggagat cttgtatgtg       480
     ggggatcggc tggacaacga catccggcct gcggtggcag tggggttgaa gacggcgctg       540
     atccgccggg gtccgtgggg aatcatccag caggacgatc cggatgcgga ccggttgccg       600
     acgatgcgga ttgattccct cacggagttg cccagcagaa tcgcggagtt caacgcttca       660
     gcgcgctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page