(data stored in ACNUC30630 zone)

EMBL: CP001738.PE308

CP001738.PE308       Location/Qualifiers
FT   CDS_pept        complement(345142..345585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0315"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: sil:SPO3410 anti-sigma B factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95917"
FT                   /db_xref="GOA:D1A1J5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACY95917.1"
FT                   /translation="MGFSLALPRESLSIRILRRVLGDALRGLGVAEDCIGDILVAASEA
FT                   CTNVVQHSRTPLDYEVIARVNDGVCALTVTDHGRGLTSGPAAGDPEQAESGRGIKIMHA
FT                   LMDDVTFDTRPGYGTAVHMSKRLTWKDEAPLRRLQGDLVHSAR"
     atggggttct cgctcgcgct gccacgcgag tcgctgagca tccggatact gcgccgggtt        60
     ctcggcgacg cgctgcgcgg cttgggcgtc gccgaggact gcatcggcga catcctcgtc       120
     gccgcctccg aggcctgtac caatgtggtc cagcactcgc gcaccccgct ggactacgag       180
     gtcatcgccc gggtgaacga cggcgtgtgc gcactgaccg tcaccgatca cggccgcggg       240
     ctgaccagcg ggcccgccgc aggcgacccc gagcaggccg agtccggccg cggcatcaag       300
     atcatgcacg ccctgatgga cgacgtgact ttcgacaccc gccccgggta cggcaccgcg       360
     gtccacatgt ccaagcggct gacctggaaa gacgaggccc cgctacggcg actccagggc       420
     gatctggtgc acagcgccag gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page