(data stored in ACNUC30630 zone)

EMBL: CP001738.PE312

CP001738.PE312       Location/Qualifiers
FT   CDS_pept        349159..349719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0319"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   dol:Dole_1053 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95921"
FT                   /db_xref="GOA:D1A1J9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1J9"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ACY95921.1"
FT                   /translation="MTAPAARDRSPRIAPGGLRQVGPFTWLLARISGRIAGTGPLALFL
FT                   TLGRHRRLFHAWLWFAGRLMPGGRLPRRESELVILRVAHLRGCRYEWEHHVRLGHRAGL
FT                   GPADIDRVTQGPGAEGWTPRERALLTAADRLHHHRDLDDDTWRLLREHLTEPECIELCM
FT                   LASHYEMLATVIAALRIQPDAPR"
     atgaccgccc ccgcagctcg tgatcgttcc cctcggatcg ctcccggcgg gctgcgccag        60
     gtcggcccgt tcacctggct gctggcgcgc atttccggcc ggatcgccgg caccggcccg       120
     ctcgcgctgt ttttgaccct gggacggcac cgccggctgt tccacgcctg gctgtggttc       180
     gccggccggc tcatgcccgg cggccggctg ccccgccgcg agagcgaact ggtcatcttg       240
     cgcgtggccc acctgcgcgg ctgccgctac gagtgggagc accacgtccg gctcggccac       300
     cgcgccggcc tgggcccggc cgacatcgac cgggtcaccc aggggcccgg cgccgagggc       360
     tggacgcctc gggagcgcgc cctgctgacc gccgccgacc ggctgcacca ccaccgggac       420
     ctcgacgacg acacctggcg gctgctgcgc gagcacctca ccgagcccga gtgcatcgag       480
     ctgtgcatgc tggcctccca ctacgagatg ctcgccaccg tcatcgcggc cctgcgcatc       540
     cagcccgacg caccccgcta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page