(data stored in ACNUC30630 zone)

EMBL: CP001738.PE317

CP001738.PE317       Location/Qualifiers
FT   CDS_pept        complement(354374..355216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0324"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: scl:sce8968
FT                   nucleotide-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95926"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K4"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACY95926.1"
FT                   /translation="MAKEAPMTILVTGATGNVGRPLVEQLLAAGHRVRALTRDPAKADL
FT                   PAGAEAVAGNLADTDTLVAAFDGVTAAHLITFDAATYGPLTNGAEIVELACKAGVRHVT
FT                   LLAGDVDKSPLEQAVQASTLHWTRLAPVEFMSNTLEWAESIRTEGLVREGFPTARSALV
FT                   HDADIAAVAAVALTEDGHHGKEYWITGPQALTIPERVQIIGQVLGRDIRYVELTQEEVI
FT                   ARWRQEGYSDDDIGFFLQMRTNPPEAGRTVLPTVQEVTGKPARTFAQWVKENAAAFTA"
     atggcgaaag aagcccccat gaccatcttg gtgaccggtg cgaccggtaa tgtcggacgt        60
     cccctggtgg agcaactgct ggccgccggg caccgcgtgc gcgccctgac ccgcgacccg       120
     gccaaagcgg acctgcccgc cggagccgaa gccgtggccg gcaacctggc cgacaccgac       180
     accctggtcg ccgccttcga cggcgtgacc gccgcccacc tgatcacctt cgacgccgcc       240
     acctacgggc ccctcaccaa cggcgcggaa atcgtggagc tggcctgtaa ggccggcgtc       300
     cgccacgtca ccctgctggc cggcgatgtg gacaaaagcc ccctggagca ggcggtgcaa       360
     gcctccactc tgcactggac ccgcctggcc ccggtggagt tcatgtccaa caccctggag       420
     tgggccgagt ccatccgcac cgaaggattg gtccgcgaag gcttccccac cgcccgcagc       480
     gccctggtgc acgacgccga catcgccgcc gtcgccgccg tcgccctcac cgaagacggc       540
     caccacggca aggagtactg gatcaccggc ccccaggccc tgaccatccc cgaacgggtg       600
     cagatcatcg gccaggtcct cggccgcgac atccgctatg tggaactgac ccaggaggag       660
     gtcatcgccc gctggcggca ggagggctac tccgatgacg acatcgggtt cttcctgcag       720
     atgcgcacca acccgcccga ggccggccgc accgtcctgc ccaccgtgca ggaggtcacc       780
     ggcaaacccg cccgcacctt cgcccagtgg gtgaaggaga acgccgccgc cttcaccgcc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page