(data stored in ACNUC30630 zone)

EMBL: CP001738.PE321

CP001738.PE321       Location/Qualifiers
FT   CDS_pept        358584..359726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0328"
FT                   /product="pyruvate dehydrogenase (acetyl-transferring) E1
FT                   component, alpha subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="KEGG: gme:Gmet_2509 dehydrogenase, E1 component;
FT                   TIGRFAM: pyruvate dehydrogenase (acetyl- transferring) E1
FT                   component, alpha subunit; PFAM: dehydrogenase E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95930"
FT                   /db_xref="GOA:D1A1K8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1K8"
FT                   /inference="protein motif:TFAM:TIGR03181"
FT                   /protein_id="ACY95930.1"
FT                   /translation="MTIDSARGAPASGLQQAPPPELIQLLTPEGVRVEHPDYPLELTPE
FT                   EVRALYRDLVMVRRIDMEAVALTRQGELGLWASLLGQEAAQVGSGRALGERDMVFPTYR
FT                   EHGVAWCRGVDPIRLLSLFRGLSNGGWDPAEHNFHLYTIVIGSQTLHATGYAMGIQRDG
FT                   VLGTDKAAAAIAYFGDGATSQGDVNESFVFASVFNAPIVFFCQNNQWAISEPLEKQTRI
FT                   PLYRRAQGFGFPGLRVDGNDVFACLAVTRRALEAARSGQGPTLIEAYTYRMGAHTTTDD
FT                   PTRYRLEAELEAWKLKDPIERVKAYLIKNEQADAEFLAGVEEEAKQYAADLRRRCLQLP
FT                   DPEPGAIFEHVYAEPHPLITEEQREYAAYLESFEDEGERS"
     gtgaccatcg actccgcacg cggtgcgccg gccagcggcc tgcaacaggc cccgccgccc        60
     gagctcatcc agttgctgac tcccgagggc gtccgggtcg agcaccccga ctaccccctg       120
     gagctgaccc ccgaagaagt ccgcgccctc taccgcgatc tggtgatggt ccgccgcatc       180
     gacatggagg cggtggcgct gacccgccag ggcgagctcg gcctgtgggc gtccctgctg       240
     gggcaggagg cggcgcaggt cgggtcggga cgggcgctgg gcgaacgcga catggtgttc       300
     ccgacctacc gggagcacgg cgtggcctgg tgccggggcg tggacccgat ccggctgctg       360
     tcgctgttcc gggggctgag caacggcggc tgggacccgg ccgagcacaa cttccacctg       420
     tacacgatcg tcatcggcag ccagaccctg cacgccacgg gctacgccat gggcatccag       480
     cgggacggcg tgctgggcac cgacaaggcc gccgccgcca tcgcctactt cggggatggg       540
     gcgacctccc agggcgatgt caacgagtcg ttcgtgttcg cctcggtgtt caacgccccg       600
     atcgtgttct tctgccagaa caaccagtgg gccatctccg agccgctgga gaagcagacc       660
     cgcatccccc tgtaccgccg ggcccagggc ttcggcttcc ccggcctgcg ggtggacggc       720
     aacgacgtgt tcgcctgcct ggcggtcacg cgccgggccc tggaggccgc ccgcagcggc       780
     cagggcccca cgctgatcga ggcctacacc taccggatgg gcgcgcacac caccaccgac       840
     gaccccaccc gctaccggct ggaggccgag ctggaggcct ggaagctcaa agaccccatc       900
     gaacgcgtca aggcgtacct gatcaaaaac gagcaggccg acgccgagtt cctcgccggg       960
     gtcgaggagg aggccaagca gtacgcggcc gacctgcgcc gccgctgcct gcagctgccc      1020
     gaccccgagc ccggggcgat cttcgagcac gtctacgccg agccccaccc gctgatcacc      1080
     gaggagcagc gcgagtacgc cgcctatctg gagtcgttcg aggacgaggg ggagcggtca      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page