(data stored in ACNUC30630 zone)

EMBL: CP001738.PE323

CP001738.PE323       Location/Qualifiers
FT   CDS_pept        360736..362307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0330"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: catalytic domain of components of various
FT                   dehydrogenase complexes; biotin/lipoyl attachment domain-
FT                   containing protein; E3 binding domain protein; KEGG:
FT                   scl:sce1569 dihydrolipoyllysine-residue acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95932"
FT                   /db_xref="GOA:D1A1L0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L0"
FT                   /inference="protein motif:PFAM:PF00198"
FT                   /protein_id="ACY95932.1"
FT                   /translation="MPEIKTFKLPDVGEGLTEAEIVRWHVHPGDRVEVNQVIVEIETAK
FT                   AVVELPCPYEGTVAELLVEEGRTVEVGTPIISVSVPAGEAGESAPPPAPDGAAEPGPRQ
FT                   DPETGPSEPARQPVLVGYGVRPGATRRRPRKRPAAIRHARPAPAPHALAKPPVRKLARD
FT                   LGVDLSTVTGTGPHGTITREDVRQAAERAATSPAPPAVERPGFAEVPQAPVHEGRGPAE
FT                   MPQEAGGVPGGEAVRGLTEMPGGVLPGRQGRGPAEMPGGLAEVSAPGEARAVQEGAAGP
FT                   AVPSAGGREERVPVRGVRKSTAAAMVGSAFTAPQVTEFLQVDVTETMETVRRLRELPEF
FT                   AELKVTPLLLVAKALLTAVRRHPMINSSWADGGEAGDEIVVRHYVNLGIATATSRGLLV
FT                   PNVKDADRLTLPELAAALGRLVEEARAGRARPADLTGGTITITNIGVFGVDAGTPILTP
FT                   GEAAILAFGQIRDMPWVHQGELAVRKVTTLALTFDHRIVDGELGSAVLRDIGAMLENPL
FT                   RLLAWS"
     atgcccgaga tcaagacgtt caagctgccg gacgtgggcg agggcctgac cgaggccgag        60
     atcgtccgct ggcatgtgca cccgggcgac cgggtcgagg tcaaccaggt catcgtggag       120
     atcgagaccg ccaaggccgt ggtggagctg ccctgcccgt atgagggcac ggtcgccgag       180
     ctgctggtgg aggagggccg cacggtcgag gtgggcaccc ccatcatctc cgtgtcggtc       240
     cccgccgggg aggccgggga gagcgctccg ccgcccgccc cggacggtgc ggccgaaccc       300
     ggcccccggc aggaccccga gaccgggccg tccgagccgg cccggcagcc ggtgctggtc       360
     gggtacgggg tgcggcccgg cgccacccgc cgccgccccc gcaagcggcc cgcggccatc       420
     cgccacgccc ggcccgcccc cgcgccccat gccctggcca agccgccggt ccgcaaactg       480
     gccagggacc tgggcgtcga tctgtccacc gtcaccggca ccggccccca cggcacgatc       540
     acccgcgagg acgtgcgcca ggccgccgaa cgcgccgcga cctccccggc gccgcccgcc       600
     gtcgaacgcc cgggtttcgc cgaagtcccg caggcaccgg tgcacgaggg gcgaggccct       660
     gccgagatgc cgcaggaggc cggcggcgtt cccggcgggg aagcggtacg cggtctcact       720
     gagatgcccg gaggtgttct gcccggacgc caagggcggg gacctgccga aatgccgggc       780
     gggctcgccg aagtttcggc gcctggagaa gcacgggccg tccaggaagg cgcggcggga       840
     cccgccgtcc cctcggccgg cggccgggag gagcgcgtcc cggttcgcgg ggtgcgcaag       900
     agcaccgccg cggcgatggt cggttcggcg ttcaccgcgc cgcaggtcac cgagttcctg       960
     caggtggacg tcaccgagac gatggagacg gtgcggcggc tgcgggagct gccggagttc      1020
     gccgagctga aggtgacccc gctgctgctg gtcgccaagg cgctgctgac ggcggtgcgg      1080
     cggcacccga tgatcaactc ctcttgggcg gacggcggcg aggccggcga tgagatcgtg      1140
     gtcaggcact acgtcaacct cggcatcgcc accgccacct cgcgcggcct gctcgtcccc      1200
     aacgtcaagg acgccgaccg gctgacgctg cccgagctgg cggcggcgct gggccggctg      1260
     gtcgaggagg cccgcgccgg gcgggcccgg ccggccgatc tgaccggcgg gacgatcacc      1320
     atcaccaaca tcggggtctt cggggtggac gccggcactc cgatcctgac cccgggcgag      1380
     gccgccatct tggcgttcgg gcagatccgg gacatgccct gggtgcatca gggcgagctg      1440
     gcggtccgca aggtcaccac gctggcgctg acgttcgatc accgcatcgt ggacggcgag      1500
     ctcggctcgg ccgtgctgcg cgacatcggc gccatgctgg agaacccgct gcgcctgctc      1560
     gcctggagct ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page