(data stored in ACNUC30630 zone)

EMBL: CP001738.PE327

CP001738.PE327       Location/Qualifiers
FT   CDS_pept        364655..366877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0334"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   cvi:CV_0762 carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95936"
FT                   /db_xref="GOA:D1A1L4"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L4"
FT                   /inference="protein motif:PFAM:PF02554"
FT                   /protein_id="ACY95936.1"
FT                   /translation="MSTPTVTPPPTVPASRRTALRKIVIWSAVSLLGAVAWAMIALVRG
FT                   EEVSAAWLVFAALASYAIAYRFYARFIACKVLRVDDTRATPAERLDDGIDYHPTDRRVL
FT                   FGHHFAAIAGAGPLVGPVLAAQMGYLPGTIWIIVGVIFAGAVQDMVVLFFSMRRSGRSL
FT                   GQMARQEIGPVGGAAALVAVLAIMIILLAVLALVVVNALKDSPWGAFSIAMTVPIALFM
FT                   GCYLRYLRPGRVVEASAIGVALLLAAIGAGGWVAESSLAGAFTLSGETLVIALVVYGFV
FT                   ASVLPVWMLLAPRDYLSAFMKVGVVVLLAGAILAARPALRTEAFTEFAFTGQGPVFAGS
FT                   LFPFVFIIIACGALSGFHALVSSGTTPKMIMKESQVRLIGYGGMLTESFVAIMALVAAC
FT                   IIDPGLYFAMNMPAPALGPTLETASAAVANLGFVITPDQLAAAARSVEEATLAGRSGGA
FT                   PTLAIGISEIFSGVLGGDALKAFWYHFAIMFEALFILTTVDAGTRVGRFMLQDTVGNVW
FT                   KKAGDVGWRPGVYAASAVIVGAWGYFLWAGVRDPLGGINQLFPLFGIANQLLAAIALAV
FT                   CTTLLIKTGRAKWAWVTLIPLAWDAAVTLTASWQKVFSADPKIGFFAQREQYAQALQAG
FT                   QTSLGTATTREQMEQVVVNTTVDGVLAALFAVLVVVILIDASRVWIKALRAGRPLPTHE
FT                   DPYVKSELWAPSGLIATAEERRLMRRRPPAAATAGTGADTDAGAPA"
     gtgtccaccc caacggtcac tccccctccc accgtccccg cctcccgccg caccgccctg        60
     cggaagatcg tcatctggag cgcggtcagc ctgctcggag ccgtcgcctg ggcgatgatc       120
     gccctggtca gaggcgagga ggtctccgcc gcctggctgg tgttcgccgc cctggcctcc       180
     tacgccatcg cctaccgctt ctacgcccgc ttcatcgcct gcaaagtgct gcgggtcgac       240
     gacacccgcg ccacccccgc cgaacggctc gacgacggca tcgactacca ccccaccgac       300
     cggcgggtgc tgttcggcca ccacttcgcc gccatcgccg gggccgggcc gctggtcggg       360
     ccggtgctgg ccgcgcagat gggctacctg cccggcacca tctggatcat cgtcggcgtc       420
     atcttcgccg gcgccgtcca ggacatggtg gtgctgttct tctccatgcg ccgcagcgga       480
     cgcagcctgg gccagatggc ccgccaggag atcggcccgg tgggcggggc ggcggcgctg       540
     gtcgccgtgc tcgccatcat gatcatcctg ctggcggtgc tggcgctggt ggtggtcaac       600
     gcgctcaagg actccccctg gggcgccttc tcgatcgcca tgaccgtccc gatcgccctg       660
     ttcatgggct gctacctgcg ctatctgcgg cccggcaggg tggtggaggc ctccgccatc       720
     ggggtggcgc tgctgctggc ggcgatcggc gccggcggct gggtggccga gtcctccctg       780
     gccggcgcct tcaccctctc cggcgagacg ctggtgatcg cgctggtggt ctacggcttc       840
     gtggcctcgg tgctgccggt gtggatgctg ctggccccgc gcgactacct gagcgcgttc       900
     atgaaggtcg gcgtggtggt gctgctggcg ggcgcgatcc tggcggcccg gccggcactg       960
     cgcaccgagg cgttcaccga gttcgccttc accggccagg gcccggtgtt cgccggctcg      1020
     ctgttcccct tcgtgttcat catcatcgcc tgcggcgcgc tgtcggggtt ccacgccctg      1080
     gtctcctccg gcaccacccc caagatgatc atgaaggagt cccaggtccg gctgatcggc      1140
     tacggcggca tgctgaccga gtcgttcgtg gcgatcatgg cgctggtggc ggcctgcatc      1200
     atcgaccccg gcctgtactt cgccatgaac atgcccgccc ccgccctcgg ccccaccctg      1260
     gagaccgcct cggcggccgt ggcgaacctg ggctttgtca tcacccccga ccagctggcc      1320
     gccgccgccc gctcggtgga ggaggccacg ctggccggcc gcagcggcgg cgcccccacg      1380
     ctggccatcg ggatcagcga gatcttctcc ggcgtcctcg gcggcgacgc cctcaaggcg      1440
     ttctggtacc acttcgcgat catgttcgag gcgctgttca tcctgaccac ggtggacgcc      1500
     ggcacccgcg tcggccgctt catgctgcag gacaccgtcg gcaacgtctg gaagaaggcc      1560
     ggggacgtcg gctggaggcc cggcgtctat gccgccagcg ccgtcatcgt cggcgcctgg      1620
     ggctacttcc tgtgggccgg ggtgcgcgac cccctcggcg gcatcaacca gctcttcccg      1680
     ctgttcggca tcgccaacca gctgctggcg gccatcgcgc tggcggtctg caccacgctg      1740
     ctgatcaaaa ccggccgggc gaagtgggcg tgggtgacgc tgataccgct ggcctgggac      1800
     gccgcggtca ccctcaccgc gtcctggcag aaggtcttct ccgccgatcc caagatcggc      1860
     ttcttcgccc agcgggagca gtacgcccag gccctgcagg ccggccagac ctccctgggc      1920
     accgccacca cccgcgagca gatggaacag gtcgtggtca acaccaccgt cgacggcgtc      1980
     ctggcggccc tgttcgccgt cctggtcgtc gtcatcctga tcgacgcctc ccgcgtgtgg      2040
     atcaaggcgc tgcgcgccgg ccgccccctg cccacccacg aggacccgta tgtgaagtcc      2100
     gagctttggg ccccgtccgg cctgatcgcc accgccgagg aacgccgcct catgcggcgg      2160
     cgcccaccgg ccgccgccac ggccggaacc ggtgcggaca ccgacgccgg agcgcccgca      2220
     tga                                                                    2223
//

If you have problems or comments...

PBIL Back to PBIL home page