(data stored in ACNUC30630 zone)

EMBL: CP001738.PE330

CP001738.PE330       Location/Qualifiers
FT   CDS_pept        368292..369491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0337"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95939"
FT                   /db_xref="GOA:D1A1L7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A1L7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95939.1"
FT                   /translation="MAAGDTPERIGVRIARERKRRGLTQLGLAQRANYSRSHIAQVEAG
FT                   HKMATPAFIAAVAAALGVSPARLYGQPFYENSPVRGAVHTHIPEIRRVLALVDVPPDLE
FT                   GPPRRLTELDAELAMIRRLQVASRYSRIGERLPALLQELSWHAHHTEQARVWHMLFLAQ
FT                   EAAADLCRKLGYHDLAGTCLDRAAESARRAQDPHLPLLVVFRRSLLLLAVAQWRSALTL
FT                   LDRAVRAVDHSREDAAEVLGTAHLRAAIAAARAGDAATAWDHHGQAVEIRRRAGRAPGD
FT                   RHGITTGFVTGNVAIHGAAVAVELGDMDEAVRRDRRIHPRLLADLPPERRAHHEIDMSR
FT                   ALLETGDYGRALQRLEKAEQIAPQLTYFHPSARSAVAHLVDVRRTLPEPLRRLQSHMGV
FT                   "
     atggctgctg gcgatactcc cgaacgaatc ggcgtccgca tagcccgtga gcgcaagcgg        60
     cgtggtctca cgcagctcgg cttggcccag cgggcgaact attcccgttc tcatatcgcc       120
     caggtggagg ccgggcacaa aatggccacc ccggcgttca ttgccgccgt ggccgcggcc       180
     ctgggagtca gcccggcccg cctgtacggc cagcccttct acgagaacag ccccgtccgg       240
     ggcgccgtgc acacgcacat cccggaaatc cgccgggtgc tggccctcgt cgatgttccc       300
     cccgacctgg aggggccgcc gcgccgcctg accgagctgg acgccgagct ggccatgatt       360
     cgcagactgc aggtggcctc ccgctattcc cggatcgggg agcggctgcc cgcactgctg       420
     caggagctgt cctggcacgc ccaccacacc gagcaggcgc gggtgtggca catgctgttc       480
     ctcgcccagg aggccgccgc ggacctgtgc cgcaagctcg gctaccacga cctggccggc       540
     acctgcctgg accgggccgc ggagtcggcg cgccgcgccc aggatccgca cctgccgctg       600
     ctggtggtct tccgccgatc gctgctgttg ctggccgtcg cccagtggcg gtcggccctg       660
     accctgctgg accgggccgt ccgggcggtc gaccactccc gtgaggacgc cgccgaagtc       720
     ctgggcaccg cgcacctgcg agccgcgatc gccgcggccc gcgcaggaga cgccgcaacc       780
     gcatgggacc accacggcca ggccgtcgaa atccgcagac gcgccggccg ggcgcccggt       840
     gaccggcacg gaatcaccac cggcttcgtc accggaaacg tggcgatcca cggcgcggcg       900
     gtcgccgtcg aactgggcga catggacgag gcggtccgcc gggaccgccg aattcacccc       960
     cgccttctgg cggatctgcc acctgaacga cgagcgcacc acgaaatcga catgtcacgg      1020
     gcgctgctgg agaccggcga ctacggccgc gcgcttcaac gcttggagaa ggccgaacag      1080
     atcgccccgc aactgactta cttccacccc tcggcccggt cggcggtggc gcacctggtg      1140
     gacgtccgcc gaaccctgcc cgaaccgctg cgcaggctcc aaagccatat gggcgtatag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page