(data stored in ACNUC30630 zone)

EMBL: CP001738.PE334

CP001738.PE334       Location/Qualifiers
FT   CDS_pept        371972..372904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0341"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   spe:Spro_0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95943"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACY95943.1"
FT                   /translation="MRWPLGRPRMDAFAGLVGVPVAEGDGGVSGMFLGTSSVLLRDGDT
FT                   ALLTDGFFTRPGWLRVGLGRIAPDREVIDACLRRAGIGHAGSLAAVICVHSHYDHAMDA
FT                   PVIAERLGAKLVGSHSSANIGRGHGLPEEALRTVEDGETVRFGDFEVTFVVGVHCPGDL
FT                   APGAIDAPLSPPARARAYRTGEAYSVFFRHPLGTVLVHGSAGFVPGRLDGHRADIVYLG
FT                   IGQLGKQDDDYRRRYWAEIVRATGAEVVIPIHWDDFTTPLLTAPLRPFPYFADDVAVSM
FT                   RFLVEQSRRDGVRLVLPDLWRETTLLPVR"
     atgcggtggc ctttgggacg tccgcggatg gacgcgttcg ccgggctggt cggcgttccg        60
     gtggccgagg gggacggcgg ggtgtcgggg atgttcctgg ggaccagcag cgtgctgctg       120
     cgggacgggg acaccgcgct gctgaccgac gggttcttca cccggccggg ctggctgcgg       180
     gtggggctgg ggcggatcgc gcccgaccgg gaggtgatcg acgcctgcct gcggcgggcg       240
     ggcatcgggc atgccgggtc gctggcggcg gtgatctgcg tccactccca ctacgaccac       300
     gccatggacg ccccggtgat cgccgagcgg ctgggggcga agctggtggg gtcgcactcc       360
     agcgccaaca tcgggcgcgg gcacgggctg cccgaggagg cgctgcgcac cgtggaggac       420
     ggggagacgg tgcgcttcgg ggatttcgag gtcacgttcg tcgtcggcgt gcactgcccc       480
     ggcgacctgg cccccggcgc catcgacgcg ccgctgtccc cgcccgcccg ggccagggcg       540
     taccggacgg gcgaggcgta ctcggtgttc ttccgccacc cgctggggac cgtgctggtc       600
     cacggcagcg ccggtttcgt gccgggacgg ctggacgggc accgcgccga catcgtctac       660
     ctgggcatcg gccagctcgg caagcaggac gacgactacc gccgccgcta ctgggcggag       720
     atcgtccgcg ccaccggcgc cgaggtcgtc atcccgatcc actgggacga cttcaccacc       780
     cccttgctga ccgccccgct gcgcccgttc ccctacttcg ccgacgacgt cgccgtctcg       840
     atgcgcttcc tggtcgagca gagccgccgc gacggcgtcc gcctggtcct gccggacctt       900
     tggcgggaga ccacccttct tcccgtccgc tag                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page