(data stored in ACNUC30630 zone)

EMBL: CP001738.PE339

CP001738.PE339       Location/Qualifiers
FT   CDS_pept        complement(377930..378520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0346"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ank:AnaeK_3256
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95948"
FT                   /db_xref="GOA:D1A2C8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACY95948.1"
FT                   /translation="MPRITAPTVAEHRARRYAELLEAARRIVLADGPEAVTPGAVGARI
FT                   GLARSSVYKYFPTSRDILVHLLEEIFQRWNARLGEVMAAQAGPAERVTAYIRTFLEFAG
FT                   SEEHRIADAIGFPSLPPQDAARIRVLHRRLTEPLCQALIELGDPSPQITMELMVGTLNA
FT                   ATRLIAQGHSKAQITAATLAFIRPPGTCGRPER"
     ttgccgagga tcaccgcccc gaccgtcgcc gagcaccgcg cccgccggta cgccgagctg        60
     ctggaggcgg cccggcggat cgtgctcgcc gatgggccgg aggcggtgac tccgggcgcg       120
     gtcggcgccc gcatcgggct ggcccgctcc agcgtctaca agtacttccc cacctcccgc       180
     gacatcctgg tgcacctgct ggaggagatc ttccagcggt ggaacgcccg gctcggcgag       240
     gtgatggccg cccaggccgg ccccgccgag cgggtgaccg cctacatccg gacgttcttg       300
     gagttcgccg ggagcgagga gcaccgcatc gccgacgcca tcggctttcc cagcctgccg       360
     ccgcaggacg cggcgcggat ccgcgtcctg caccggcggc tgaccgagcc gctctgccag       420
     gccctgatcg agctgggcga cccgtccccg cagatcacca tggagctgat ggtcggcacg       480
     ctgaacgccg ccacccgcct gatcgcccag gggcattcca aggcgcagat caccgccgcg       540
     accttggcgt tcatccgccc tccggggacg tgcggccgtc cggagcggtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page