(data stored in ACNUC30630 zone)

EMBL: CP001738.PE340

CP001738.PE340       Location/Qualifiers
FT   CDS_pept        complement(378542..379231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0347"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: dar:Daro_1671 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95949"
FT                   /db_xref="GOA:D1A2C9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2C9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACY95949.1"
FT                   /translation="MTATTATTTGLALEQVTLEYGTGDTLVTALDEVTLTVEPGEFVAV
FT                   VGPSGSGKSSLLAVAGALIHPTRGQVRIADVTVSGAKAAELARLRRTRIGYVFQSGNLL
FT                   ASLTARDQLLLVPHLSGRITAEDRARADELLEAVGLTAKADRRPHELSGGERQRVGLAR
FT                   ALMNRPAVLLADEPTAALDRRRAREIVALLAAQAHERKAATVMVTHDTDLLEAADRVVH
FT                   MRDGKLS"
     atgaccgcca ccaccgccac cacgaccggg ctggccctgg agcaggtcac cttggagtac        60
     gggacgggcg acacgctggt gaccgcgctg gatgaggtca ccttgaccgt ggagcccggg       120
     gagttcgtcg cggtcgtcgg cccgtcgggg tcgggcaagt ccagcctgct ggccgtggcg       180
     ggcgcgctga tccaccccac ccggggccag gtgcgcatcg ccgatgtgac cgtctccggc       240
     gccaaggccg ccgagctggc gaggctgcgc cgcacccgga tcggctacgt cttccaaagc       300
     ggcaacctgc tggcctcgct gaccgcccgc gaccagctgc tgctggtgcc gcacctgtcg       360
     gggcggatca ccgccgagga ccgggcccgc gccgacgagc tgctggaggc ggtcgggctg       420
     accgccaagg ccgaccgccg cccgcacgag ctgtccggcg gcgagcggca gcgggtcggg       480
     ctggcccgcg cgctgatgaa ccggccggcg gtgctgctgg ccgacgagcc caccgcggcg       540
     ctggaccgcc gccgggcccg tgagatcgtg gcgctgctgg ccgcccaggc gcacgagcgc       600
     aaggccgcca ccgtgatggt cacccacgac accgacctgc tggaggccgc cgaccgggtc       660
     gtccacatgc gggacggcaa gctgtcctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page