(data stored in ACNUC30630 zone)

EMBL: CP001738.PE343

CP001738.PE343       Location/Qualifiers
FT   CDS_pept        381765..383153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0350"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: gme:Gmet_1930 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95952"
FT                   /db_xref="GOA:D1A2D2"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D2"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACY95952.1"
FT                   /translation="MNALDLARWQFGITTVYHFIFVPLSIGLAALVAVMQTIWYRRKDP
FT                   RYLRMTKFFGKLLLINFAVGVVTGIVQEFQFGMNWSDYSRFVGDVFGAPLAMEGLLAFF
FT                   LESTFLGLWIFGWDKLKPAVHLATIWLFAIGTALSAYFIIAANSWMQHPVGYRINPDTK
FT                   RAELTSIWEVLTNPTTLAAYPHVIFASLITAGMLIAGVAAWYLYKHRDTDVFRPALRLG
FT                   LIVSLVASIGVFISGDIQARVMTEQQPMKMAAAEALYETSAPASFSLFTIGSLDGREEL
FT                   WSLRIPHLLSFMATGDPNGQVEGINDVQRAYEALYGPGSYIPVVPITYWNFRLMIGFGA
FT                   LAAAIALWGLWLTRDGRTPRSRWFTRAALIGIALPYLANTTGWIFTEMGRQPWVVHGML
FT                   RTADGVSPTVGGAEVIVSLAVFTVLYGVLAVVAGVLMTRFAKQGPPKEEELPKEDEPMP
FT                   SFTY"
     gtgaacgccc tggacctagc ccgatggcag ttcgggatca caaccgtcta tcacttcatc        60
     ttcgtaccgc tgagcatcgg cctggccgcc ctggtggcgg tcatgcagac gatctggtac       120
     cgccgcaagg acccgcggta cctgcggatg accaagttct tcggcaagct gctgctgatc       180
     aacttcgccg tgggcgtggt caccgggatc gtccaggaat tccagttcgg catgaactgg       240
     tcggactact cgcggttcgt cggtgacgtg ttcggcgccc cgctggccat ggaagggctg       300
     ctggcgttct tcctggagtc caccttcctg gggttgtgga tcttcgggtg ggacaagctc       360
     aagccggcgg tgcacctggc caccatctgg ctgttcgcga tcggcaccgc gctgtcggcc       420
     tacttcatca tcgccgccaa ctcctggatg cagcacccgg tcggctaccg gatcaacccc       480
     gacaccaagc gggccgagct gaccagcatc tgggaggtgc tgaccaaccc caccacgctg       540
     gcggcctacc cgcacgtcat cttcgcgtcg ctgatcaccg ccggcatgct gatcgccggg       600
     gtcgccgcct ggtacctgta caagcaccgc gacaccgacg tgttccgccc ggcgctgcgg       660
     ctgggcctga tcgtctcgct ggtggcgtcg atcggcgtgt tcatctccgg cgacatccag       720
     gcccgcgtga tgaccgagca gcagccgatg aagatggccg cggccgaggc gctgtatgag       780
     acctccgcgc cggcgtcctt ctcgctgttc accatcggca gcctggacgg ccgcgaggag       840
     ctgtggagcc tgcggatccc gcacctgctg tcgttcatgg ccaccggcga ccccaacggc       900
     caggtcgagg gcatcaacga cgtgcagcgc gcctacgagg ccctctacgg ccccggcagc       960
     tacatccccg tcgtcccgat cacctactgg aacttccggc tgatgatcgg cttcggggcg      1020
     ctggccgccg cgatcgcgct gtggggcctg tggctgaccc gcgacggccg caccccgcgc      1080
     agccgctggt tcacccgcgc ggcgctgatc gggatcgcgc tgccctacct ggccaacacc      1140
     accggctgga tcttcaccga gatgggccgg cagccgtggg tggtgcacgg gatgctgcgc      1200
     accgccgacg gcgtctcccc gacggtcggc ggcgccgaag tgatcgtctc gctggcggtc      1260
     ttcaccgtcc tgtacggagt gctggccgtg gtggcgggcg tgctgatgac gcgcttcgcc      1320
     aagcaggggc cgcccaagga agaggagctg ccgaaggaag acgaaccgat gccctccttc      1380
     acctactga                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page