(data stored in ACNUC30630 zone)

EMBL: CP001738.PE345

CP001738.PE345       Location/Qualifiers
FT   CDS_pept        384260..385921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0352"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: afr:AFE_1388 ABC transporter, CydDC cysteine
FT                   exporter (CydDC-E) family, permease/ATP-binding protein
FT                   CydD; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95954"
FT                   /db_xref="GOA:D1A2D4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D4"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ACY95954.1"
FT                   /translation="MKPLDPRLLRHARPARIFLALTVVLGAVTTGLVLAQAALLAHALA
FT                   GAFHGRGPGELRWTLGALLAVVVARAAVHGLGEAAALHYAGTVRSLLRRRLIAHALGLG
FT                   PQWTAGKRAGEVATVATRGLDALDVYFARYLPQLALACITPVAVLAVVAGADLLSAMVI
FT                   AVTLPLIPVFMVLVGLHTKARTERQWRLLQRLGGHFLDVVEGLPTLKLFNRADAQAQVI
FT                   AEVTGAHRRITMRVLRVAFLSALVLELLSTLAVALVAVQVGLRLLNGDVPYETALLVLI
FT                   LAPEAYLPLRAVGAQFHAGMEGVAAAERAFEVLDTPLPRRPAGGGAAADLRRDRIVLDE
FT                   VTVRYPDRDRPALEKASLTIEPGERIVVVGPSGAGKSTLLSLLLRFTEPASGTVSFADV
FT                   PVESWREQISWVPQHPHLFDGTIADNIRLGRPGASPADVRRAAAQAGLAEFIEALPDGY
FT                   DTHVGERGARLSSGQRQRVALARAFLRDAPLVLLDEPTAHLDPLTAHGVQEAVHRLAAG
FT                   RTVVLVTHDPTWTHFADRVVHIEAGRLRESRSLAVA"
     atgaagccgc tcgacccccg gctgctgcgg cacgcccgcc cggcccggat cttcctggcc        60
     ctcaccgtgg tgctgggcgc cgtcaccacc ggcctggtgc tggcccaggc ggcgctgctg       120
     gcccacgcgc tggcgggcgc gttccacggc cgggggccgg gcgagctgcg gtggaccctc       180
     ggcgcgctgc tggcggtggt ggtggcccgc gccgccgtcc acggcctggg cgaggccgcc       240
     gcgctgcact acgccggcac ggtccgctcg ctgctgcggc gccgcctgat cgcgcacgcg       300
     ctgggcctgg ggccgcagtg gacggccggc aaacgcgccg gcgaggtggc caccgtcgcc       360
     acccgcggcc tggacgccct ggacgtctac ttcgcccgct acctgccgca gctggcgctg       420
     gcgtgcatca ccccggtcgc ggtgctggcc gtggtcgccg gcgcggacct gctgtcggcg       480
     atggtgatcg cggtgacgct gccgctgatc ccggtgttca tggtgctggt gggcctgcac       540
     accaaggccc gcaccgaacg ccagtggcgg ctgctgcagc ggctcggcgg ccacttcctg       600
     gacgtggtcg aagggctgcc gacgctgaag ctgttcaacc gggccgacgc gcaggcgcag       660
     gtgatcgccg aggtgaccgg cgcgcaccgg cggatcacca tgcgggtgct gcgggtggcg       720
     ttcctgtcgg cgctggtgct ggagctgctg tccacgctgg cggtggcgct ggtggccgtc       780
     caggtcgggc tgcggctgct gaacggcgac gtgccgtatg agacggcgct gctggtgctg       840
     atcctggcgc cggaggcgta cctgccgctg cgcgccgtcg gcgcccagtt ccacgccggc       900
     atggagggcg tggcggcggc cgagcgggcc tttgaggtgc tggacacccc gctgccgcgg       960
     cgcccggccg gcggcggcgc cgcggcggac ctgcggcgcg accggatcgt cctggacgag      1020
     gtgaccgtgc gctaccccga ccgcgaccgt cccgccctgg agaaggcgtc gctgaccatc      1080
     gagccgggcg agcggatcgt cgtcgtcggc cccagcggcg cgggcaagag caccctgctg      1140
     agcctgctgc tgcgcttcac cgaacccgcc tcgggcacgg tgagcttcgc cgacgtgccg      1200
     gtggagtcct ggcgcgagca gatctcctgg gtgccgcagc acccccacct gttcgacggg      1260
     accatcgccg acaacatccg gctgggccgc cccggcgcct cgcccgccga cgtccgccgc      1320
     gccgccgccc aggccgggct ggccgagttc atcgaagcgc tgcccgacgg ctacgacacc      1380
     cacgtcggcg aacgcggcgc ccgcctgtcg tcgggccagc gccagcgcgt cgccctggcc      1440
     cgcgccttcc tgcgcgacgc cccgctggtc ctgctggacg agcccaccgc ccacctggac      1500
     ccgctcaccg cccacggcgt tcaggaggcg gtgcaccgcc tggccgccgg gcgcaccgtc      1560
     gtgctggtca cccacgaccc gacctggacg cacttcgccg accgcgtcgt gcacatcgag      1620
     gcgggccggc tgagggagtc ccgttcgctg gcggtggcgt ga                         1662
//

If you have problems or comments...

PBIL Back to PBIL home page