(data stored in ACNUC30630 zone)

EMBL: CP001738.PE349

CP001738.PE349       Location/Qualifiers
FT   CDS_pept        389045..390106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0356"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_pAT_449 ferric enterobactin transport protein FepD"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95958"
FT                   /db_xref="GOA:D1A2D8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2D8"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACY95958.1"
FT                   /translation="MLTPVREAPLRDDPPQPAVAGALRRGRVAGLFLLAGLLVLIVMAS
FT                   FAIGAERVPLSRVLPGIFEPDGSQSALIIQEMRLPRTLLGLAVGASLGLAGALMQALTR
FT                   NPLAEPGVLGVNGGAALAVVLLIWLADVDQVLVYVWAAFAGAAGAVLLVYMIGSYGRAG
FT                   ATPGRLVLAGAALNAVFSALTNGVMLLDPHGFNSFRFWQVGSLAGRDLATLAQVGPFMA
FT                   AGVLLALSLARSLNVLALGEEAGRALGGSLGRTRALGALAVVLLSGAATAAVGPIAFLG
FT                   LAVPFIVRALVGPDQRWVLPYSLLLAPVLLLGADIVGRVVAPPAELETGIVTAFLGAPI
FT                   FIMLVRRGRMPKL"
     gtgttgactc cggtgcgcga ggcccccctg cgcgacgacc ccccgcaacc cgccgtggcc        60
     ggggcgttgc ggcgcggccg ggtggccggg ttgttcctgc tggccgggct gctggtgctg       120
     atcgtgatgg cgagtttcgc gatcggggcc gaacgcgtcc ccctgagccg ggtgctgccg       180
     gggatcttcg agccggacgg gtcgcagagc gcgctgatca tccaggagat gcggctgccg       240
     cgcaccctgc tggggctggc cgtgggggcc tcgctggggc tggcgggcgc gctgatgcag       300
     gcgctgaccc gcaacccgct ggccgagccg ggggtcctgg gggtcaacgg aggcgccgcg       360
     ctggcggtgg tgctgctcat ctggctggcc gacgtcgacc aggtgctggt gtatgtgtgg       420
     gcggcgttcg ccggggcggc cggtgcggtg ctgctggtgt acatgatcgg ctcctatggg       480
     cgggccggcg ccacgccggg acggctggtg ctggcggggg cggcgctcaa cgcggtgttc       540
     agcgcgctga ccaacggggt gatgctgctg gacccgcacg gcttcaacag cttccggttc       600
     tggcaggtcg gctcgctggc cggccgggac ctggccacgc tcgcccaggt cgggccgttc       660
     atggccgccg gggtgctgct ggcgctgtcg ctggcccggt cgctgaacgt gctggcgctg       720
     ggggaggagg ccgggcgggc gctcggcggc tccctgggcc gcacccgggc gctgggggcg       780
     ctggcggtgg tgctgctcag cggcgcggcg acggcggcgg tggggccgat cgccttcctg       840
     ggactggcgg tgccgttcat cgtgcgcgcc ctggtcggcc ccgaccagcg gtgggtgctg       900
     ccgtactcgc tgctgctggc gccggtgctg ctgctgggcg ccgacatcgt cgggcgggtg       960
     gtggccccgc cggccgagct ggagaccggg atcgtcaccg cgttcctggg ggcgccgatc      1020
     ttcatcatgc tggtccgccg cggaaggatg cccaagctgt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page