(data stored in ACNUC30630 zone)

EMBL: CP001738.PE352

CP001738.PE352       Location/Qualifiers
FT   CDS_pept        392042..395437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0359"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; Non- ribosomal
FT                   peptide synthetase; phosphopantetheine-binding;
FT                   condensation domain protein; KEGG: pfl:PFL_3493 pyochelin
FT                   synthetase E"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95961"
FT                   /db_xref="GOA:D1A2E1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E1"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACY95961.1"
FT                   /translation="MLTREELHQSLTQVLGEQVDPHDNLIELGMDSIRLMSLTGRLRKR
FT                   GIEITFAELAERPTLAQWWELLAERGALAPAAEPETPQEPAADAQEPDGPFPLALMQHA
FT                   YWIGRDSEQELGSVAAHLYVELDGRDIDPGRLEKAVRTLVERHPMLRVAICDDGTQRVL
FT                   PERPGPAITVLDLRRAADPQAELERVRREMSTQRLPIDTGKVFDLRLSLLPSGTARLHL
FT                   DVDMVAADAMSYRTMLADLAALYEGETLPPLRYSYARYLAADPRAQARERDRAWWAQRL
FT                   ADLPGPPELPVVPKPGHRVVRKHHWLSPEGKRQLITRAHREGVTPAMALATIFAEVIGA
FT                   WSATPRFILNLPLFHREPVHPDVDKLVGDFTGSILLEIDLTEELPFVERARAVQAKLHT
FT                   AGTHSDYSGLEVLRDLSRQRGEQVLAPIVYTSALNLGELFDERVRALFGEPVWIISQGP
FT                   QVLLDAQVTEVSGGLLLNWDVREPAFPEGVADAMFAAYTDAVTRLGAPDADWSRPLRIQ
FT                   APPEQLEIRKRLNARPAPPSRTLIEGFFANARHNPQAPAVHWDDDGTLTYGELADRALR
FT                   VAGHLVAQGVRPGDRVAIELPKGPDQAVAVLGVLAAGAAYVPIGVEQPPARREKITKTA
FT                   QIALSLTPAALTWALAQAQPLAEPVPITPGQVAYVLFTSGSTGEPKGVEVSHRAAMNTI
FT                   GDLIERFSLGPRDVSLGISALDFDLSVFDLFALWTAGGAVVIPAEEERKDAARWAELVA
FT                   RRSVTVLNCVPSVLEMLLQTGGDVRSLRVVLLGGDWVGVHLPGMLAERAPGCRFVALGG
FT                   TTETAIHSTVQEVSGPVPEDWHAVPYGVPLRGVACRVVDEQGRDRPDWVPGELWIGGGG
FT                   VAEGYCGDPERTADRFVTHEGVRWYRTGDMARYRPDGTLEFLGRRDHQVKVRGFRIELG
FT                   EIEAALESHPRVRRAVALLAGSRLAAAIVPASGEVDRQELQDHVRDLLPPHMVPELLVR
FT                   VEELPLTANGKIDRKALTALAAAEAGEAAATYVEPTTALEKVIARTIGEVLGIERVGAE
FT                   DDFFALGGDSVLATTVVARLREALDTTSLPVRVIFAQRTVSRIARRFTELEETPGRLEA
FT                   VADIWLTVADMTDEEVEAHLSGSA"
     gtgctgacca gggaagaact gcaccagtcg ctgacccagg tgctcggtga gcaggtcgac        60
     ccgcatgaca acctcatcga gctgggcatg gactccatca ggctgatgag cctgaccggc       120
     cggctgcgca aacgcggcat cgagatcacc ttcgccgagc tggccgaacg ccccaccctg       180
     gcgcagtggt gggagctgct ggccgaacgc ggcgcgctcg cccccgccgc cgagcccgag       240
     acgccccaag agcccgcggc cgacgcgcaa gagcccgacg ggccgttccc gctggcgctc       300
     atgcagcacg cctactggat cggccgcgac agcgaacaag agctcggctc ggtcgccgcc       360
     cacctgtacg tggaactgga cggccgcgac atcgacccgg ggcggctgga gaaggcggtg       420
     cggaccctgg tcgagcggca ccccatgctg cgggtggcga tctgcgacga cggcacccag       480
     cgggtgctcc ccgaacgccc cggcccggcg atcaccgtcc tcgacctgcg gcgggccgcc       540
     gacccgcagg ccgagctgga gcgggtgcgc cgggagatgt ccacccagcg gctgcccatc       600
     gacaccggca aggtcttcga cctgcggctg agcctgctgc cgtccggcac cgcccggctc       660
     cacctggatg tggacatggt cgccgccgac gcgatgagct accgcaccat gctggccgac       720
     ctggccgccc tgtacgaggg cgagacgctg ccgccgctgc gctacagcta cgcccgctac       780
     ctggccgccg acccccgcgc gcaggcccgc gaacgcgatc gcgcctggtg ggcccagcgc       840
     ctggccgacc tgcccggccc gcccgaactg ccggtcgtcc ccaagcccgg ccaccgggtc       900
     gtccgcaagc accactggct gtccccggag ggcaagcggc agctcatcac ccgcgcccac       960
     cgcgagggcg tcacccccgc catggcgctg gccacgatct tcgccgaggt gatcggcgcc      1020
     tggtcggcca ccccgcgctt catcctcaac ctgccgctgt tccaccgcga acccgtccac      1080
     ccggacgtgg acaagctggt cggcgacttc accgggtcga tcctgctgga gatcgacctg      1140
     accgaggagc tgccgttcgt cgaacgcgcc cgcgccgtgc aggccaaact gcacaccgcc      1200
     ggcacccaca gcgactactc cggcctggaa gtgctgcgcg acctgtcccg gcagcgcggc      1260
     gagcaggtgc tggcccccat cgtctacacc agcgcgctga atctgggcga gctgttcgac      1320
     gagcgcgtcc gcgccctctt cggcgaaccg gtctggatca tctcccaagg cccccaggtg      1380
     ctgctggacg cccaggtcac cgaggtctcc ggcgggctgc tgctgaactg ggacgtgcgc      1440
     gagccggcct tccccgaggg cgtggccgac gccatgttcg ccgcctacac cgacgccgtc      1500
     acccgcctgg gcgcccccga cgccgactgg agccggccgc tgcgcatcca ggcgcccccc      1560
     gagcaactgg agatccgcaa gcggctcaac gcccggcccg ccccgccctc gcgcaccctc      1620
     atcgaaggct tcttcgcgaa cgcccggcac aacccgcagg cccccgccgt ccactgggac      1680
     gacgacggca ccctcaccta cggcgaactg gccgaccggg cgctgcgcgt cgccgggcac      1740
     ctggtggccc agggcgtccg ccccggcgac cgggtcgcga tcgaactgcc caagggcccc      1800
     gaccaggccg tggccgtcct cggcgtgctg gcggccggcg ccgcctacgt gccgatcggc      1860
     gtggagcagc cccccgcccg ccgcgagaag atcaccaaga ccgcgcagat cgcgctctcc      1920
     ctcacccccg ccgcgctgac ctgggcgctg gcccaggccc agccgctggc cgaaccggtg      1980
     cccatcactc ccggccaggt cgcctacgtg ctgttcacct ccggctcgac cggcgagccc      2040
     aagggcgtgg aggtctccca ccgggccgcc atgaacacca tcggcgacct gatcgaacgg      2100
     ttctcgctcg ggccgcggga cgtctcgctg ggcatctcgg ccctggactt cgacctgtcg      2160
     gtgttcgacc tgttcgcgct gtggacggcc ggcggcgcgg tggtcatccc cgccgaggag      2220
     gagcgcaagg acgccgcccg ctgggccgaa ctggtggcgc gccggtcggt gaccgtcctc      2280
     aactgcgtcc cctcggtgct ggagatgctg ctgcagaccg gaggggacgt gcgcagcctg      2340
     cgggtggtgc tgctgggcgg cgactgggtc ggcgtccacc tgccggggat gctggccgaa      2400
     cgcgcccccg gatgccggtt cgtggcgctg ggcggcacca ccgagaccgc catccactcc      2460
     accgtccagg aggtctccgg cccggtcccc gaggactggc acgccgtccc ctacggggtg      2520
     ccgctgcgcg gggtggcctg ccgggtggtg gacgagcagg gccgcgaccg ccccgactgg      2580
     gtgcccggcg agctgtggat cggcggcgga ggcgtcgccg agggctactg cggcgacccc      2640
     gaacgcaccg ccgaccgctt cgtcacccac gagggcgtgc gctggtaccg caccggcgac      2700
     atggcccgct accgccccga cggcacgttg gaattcctcg gccgccgcga ccaccaggtc      2760
     aaggtccgcg gcttccgcat cgaactcggc gagatcgagg ccgccctgga gagccacccg      2820
     cgggtccgcc gcgccgtggc gctgctggcc ggctcccgcc tggccgccgc gatcgtgccc      2880
     gcctccggtg aggtggaccg ccaggagctg caagaccacg tccgcgacct gctgcccccg      2940
     cacatggtcc ccgaactgct ggtgcgggtg gaggagctgc cgctgaccgc caacggcaag      3000
     atcgaccgca aggccctcac cgccctggcc gccgccgagg ccggcgaggc cgccgcgacc      3060
     tacgtcgaac ccaccaccgc cctggaaaag gtcatcgccc gcaccatcgg cgaggtcctg      3120
     ggcatcgagc gcgtgggcgc cgaggacgac ttcttcgccc tgggcggcga ctccgtcctg      3180
     gccaccaccg tcgtcgcgcg cctgcgcgag gccctcgaca ccacctccct gccggtgcgc      3240
     gtgatcttcg cccagcgcac ggtctcccgc atcgcccgcc gcttcaccga actggaggag      3300
     acccccggcc gcctggaggc cgtcgccgac atctggctca ccgtcgccga catgaccgac      3360
     gaagaggtgg aggcccacct gtccggctcc gcctga                                3396
//

If you have problems or comments...

PBIL Back to PBIL home page