(data stored in ACNUC30630 zone)

EMBL: CP001738.PE360

CP001738.PE360       Location/Qualifiers
FT   CDS_pept        403786..404337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95969"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95969.1"
FT                   /translation="MRQEPDPGEDFLDALAGRLTGMPGRPVAVDLSAEDAWELVTRLDS
FT                   ALDADGVQTRMVLGAACPTTTEAIAQFVTAMQLPYRASRSWEDFLGELGERPVSQRQCL
FT                   VVTDACALLRHESFDRWRELVGGVCGGPYCMGGGWTTLVLADREPAWREWVFRPAADTA
FT                   RRSGWELPMLRGSAGASGFP"
     atgcggcagg aaccagaccc cggcgaggac tttctggacg ccctcgccgg gcggctgacc        60
     ggcatgccgg gacggccggt ggcggtggac ctttccgccg aggacgcctg ggaactggtc       120
     acgcgcctcg acagcgccct ggacgccgac ggcgtccaga cgcggatggt gctgggcgcg       180
     gcatgcccga cgaccaccga ggccatcgcc cagttcgtca cggccatgca acttccctac       240
     cgggcgagcc gaagctggga ggacttcctc ggcgagctcg gcgaacgccc tgtctcgcag       300
     cggcagtgcc tggtggtgac cgacgcctgc gccctgctgc ggcacgagag cttcgacagg       360
     tggcgggaac tggtcggtgg cgtctgcggc ggcccgtact gcatgggcgg cggctggacc       420
     accctcgtcc tggcagaccg agaacccgcc tggcgggaat gggtcttccg gccggcggcc       480
     gacaccgccc gccgaagcgg ctgggagctg cccatgttgc gggggagtgc cggggcgtct       540
     ggctttccct ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page