(data stored in ACNUC30630 zone)

EMBL: CP001738.PE365

CP001738.PE365       Location/Qualifiers
FT   CDS_pept        complement(421656..422519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0373"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95974"
FT                   /db_xref="GOA:D1A2F4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACY95974.1"
FT                   /translation="MPRPESPTVRRIMLGIRLRELRTRAGISADDAARHIARTDSTISR
FT                   METGQSSVSTRVLERLIELYQATPEEARQLTELAKAARQRGWWQRYGEVLHPGFELYLG
FT                   LEAEATEIHVYASEWVPGLLQTPDYARAILSAEPRPPAEEEIQQRVEARLARQVILGGE
FT                   DPVQYWAVLNEAVLRRIVGSPKIMRAQLEALAARARQRNIKLQVLPFTTGAHPAVGGPF
FT                   TLLSLDLGKAALAEYVYVENRAGSLVMDREAEIAIHRLTFDTFRADALSPEESVALIEK
FT                   TAAELA"
     atgccacgcc ccgagagccc cacagtccgg cggatcatgc tgggcatccg gctccgcgag        60
     ctgcgcaccc gagccgggat ctcggcagac gacgcagccc gccacatcgc acgcaccgac       120
     tcgaccatca gccgcatgga gaccggccag agctccgtgt ccacgcgggt actggaacgg       180
     ctgatcgagc tgtaccaggc aacgcccgag gaggcccggc agctgaccga gctggccaaa       240
     gcagcccgtc agcgcgggtg gtggcagcgc tacggcgagg tgctacaccc cggctttgag       300
     ctctacttgg gcctggaggc cgaggccacc gagatccacg tctacgccag cgagtgggta       360
     cccggcctgc tccagacccc cgactatgcc cgcgccatcc tgtcggccga gccgcgtcct       420
     cccgcagagg aagagatcca gcagcgcgtc gaagccagac tggcccgtca ggtgatcctc       480
     ggcggagagg accccgtaca gtactgggcc gtcctcaacg aggccgtgct acgccgaatc       540
     gtgggcagtc ccaagatcat gcgagcccaa ctcgaagccc tcgcggccag ggcacgccag       600
     cgcaatatca agctgcaggt cttgccgttc accaccggcg cgcatccggc ggtgggcggc       660
     cctttcaccc tcctgtcgct cgacctcggc aaagccgctc ttgccgagta tgtctacgtc       720
     gagaatcgag ctggctcact tgttatggac agagaggcag agatcgcgat acatagattg       780
     acattcgaca cattccgggc agatgcactc agcccggagg agtcagtcgc cctcatcgag       840
     aagaccgccg cagaactggc gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page