(data stored in ACNUC30630 zone)

EMBL: CP001738.PE367

CP001738.PE367       Location/Qualifiers
FT   CDS_pept        424007..424669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95976"
FT                   /db_xref="GOA:D1A2F6"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2F6"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3154"
FT                   /protein_id="ACY95976.1"
FT                   /translation="MTGMAGGVPASRAVGRVFFTDAASGRRSSCSASVVASDSGNLLLT
FT                   AGHCVYSRGWHRDWIFVPSYDQGKRPFGVWRAEWFVTPSRWITHGRPEDDVAFVKVASS
FT                   GGVRILDRVGGNGIRPGAATGRRRTVLGYPFLPPYRGDRQHYCEGVTRSEGRRMRMACR
FT                   LTTGASGGPWLDSYDRSTGFGYIGGVTTNTDLANTTLWSPLLGGDVWTLYRYADQLR"
     atgaccggga tggccggtgg tgtgccggcc agcagggcgg tgggcagggt gttcttcacc        60
     gacgcggcgt cggggcgccg ttcctcctgc tcggcctcgg tggtcgccag cgactcgggg       120
     aacctgctcc tcaccgcggg gcattgcgtg tacagccgcg gctggcaccg tgactggatc       180
     ttcgtcccct cctatgacca gggcaagcgg ccctttgggg tgtggcgggc ggagtggttc       240
     gtcaccccct cccggtggat cacccatgga cggcccgagg acgatgtggc cttcgtgaag       300
     gtggcctcgt ccggaggcgt caggattctc gacagggtcg gcggcaacgg catccggccg       360
     ggggccgcca cgggcaggcg gcggacggtc ctcggctacc cgttcctgcc gccctaccgg       420
     ggcgaccggc agcactactg cgaaggcgtc acccggtcgg aagggcggcg catgcggatg       480
     gcgtgccggc tcaccaccgg tgccagcggc ggtccctggc tggactccta tgaccgttcg       540
     accgggttcg gttacatcgg cggtgtcacc acgaacaccg atctggccaa caccacgctg       600
     tggagcccgc tgcttggcgg ggacgtgtgg acgctctacc ggtacgccga tcagcttcgg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page