(data stored in ACNUC30630 zone)

EMBL: CP001738.PE374

CP001738.PE374       Location/Qualifiers
FT   CDS_pept        complement(432323..434074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0382"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3450 WD-40
FT                   repeat-containing serine/threonin protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95983"
FT                   /db_xref="GOA:D1A2G3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2G3"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACY95983.1"
FT                   /translation="MKQTWSLTEFTETRELGRGAQGRVVLARHRKSGALVAIKYLERAA
FT                   PEALAGLRAEAQMLGRLRSPHVVRLYQFVETPQGAAIVMEAVNGVSLRAILDKHGALAP
FT                   EAALTVLKGSLLGLAAAHSVGVVHRDYKPANVVVREDGLSKLVDFGVAALAGQGSSSGT
FT                   PAYMAPEQWRGEPASPATDVYAATGVFLECVTGRRPFAGVEAAALMHHHLNVPVPLNDV
FT                   PEPLRPLIARGMAKDPGQRPPGAAAFVAELEATARAAYGPDWERRGIGALAGAAVALAS
FT                   LFPLTALAVTPAGAAVAGGSVASSVGQGLLATAAGKVTIAVAGTAVVAASAGTVTYATR
FT                   DASPAPRPSPAAVVTTATESWTSANPRVVLQNAQYVRVSGLRDAALQQRINRALRAPLD
FT                   RLIKMGREHAVRSRTACEGRPTQIYSTVRLGVRGPALVSVRYRLWSDWCQAADGMPAGE
FT                   VVTIDLRTGRRLTATDVFRPQTLTPTGLSRLQSLVVQREPDPPWSNCAPEGRFTRKHFG
FT                   DWTAPAGDREPPMLSAFFTPSAFELAWHVSGSDGCQTLTFTAPYAKVRDLLQPSVLSLL
FT                   NPSPTPS"
     atgaaacaga cctggagcct gacggagttc accgagaccc gggaactggg gcgcggcgcc        60
     cagggacgcg tggtgctggc ccgtcaccgc aagtccggtg ccctggtggc gatcaaatac       120
     ctggagcggg ccgccccgga ggccctggcc gggctgcgcg ccgaggccca gatgctggga       180
     cggctgcgca gcccccacgt cgtgcggctc taccagttcg tggaaacccc ccagggcgcg       240
     gcgatcgtca tggaggcggt caacggggtg tcgctgcgcg cgatcctcga caagcacggc       300
     gcactggccc ccgaggcggc gctgaccgtg ctgaaagggt cgctgctcgg gctggccgcc       360
     gcgcactcgg tgggcgtggt gcaccgcgac tacaaaccgg ccaacgtcgt ggtgcgcgag       420
     gacgggctga gcaagctcgt cgacttcggc gtggcggcgc tggccgggca gggctcgtcc       480
     tccggcaccc ccgcctacat ggcccccgag cagtggcgcg gcgaaccggc ctcaccggcc       540
     acggacgtgt acgccgccac cggcgtcttc ctcgaatgcg tgaccggacg gcggcccttc       600
     gcaggcgtgg aggcggccgc gctgatgcac caccacctga acgtccccgt cccgctgaac       660
     gacgtgcccg agccgctgcg gcccctgatc gcccggggca tggccaagga ccccgggcag       720
     cgcccgcccg gggccgccgc gttcgtggcc gagctggagg ccaccgcccg cgccgcctac       780
     gggccggact gggagcggcg cggcatcggg gcgctggcgg gcgccgccgt ggcgctggcc       840
     tccctgttcc cgctgaccgc gctggccgtg accccggcgg gggcggccgt ggcgggcggc       900
     tcggtggcct cctcggtggg ccaggggctg ctggccaccg cggcgggcaa ggtgacgatc       960
     gcggtggccg gcaccgccgt ggtcgccgcc tcggccggca cggtgaccta cgcgacccgg      1020
     gatgcctccc ccgccccgcg gccgtccccc gccgccgtcg tcaccacggc caccgagagc      1080
     tggacgagcg ccaacccgcg ggtggtgctc cagaacgccc agtacgtgcg ggtcagcggc      1140
     ctgcgcgacg ccgcgctgca gcagcggatc aaccgcgcgc tgcgggcccc gctggaccgg      1200
     ctcatcaaga tgggccgcga gcacgccgtc cgaagcagga cggcatgcga ggggcgtccc      1260
     acgcagatct actccaccgt ccgcctgggg gtgcgcggcc ccgcgctggt ctcggtgcgc      1320
     taccggctgt ggagcgactg gtgccaggcg gccgacggga tgcccgccgg ggaggtcgtc      1380
     accatcgacc tgcgcaccgg acgcaggctc accgccaccg acgtgttccg cccgcagacc      1440
     ctgacgccca cgggcctgag caggctgcag agcctggtcg tccagcgcga gccggacccg      1500
     ccgtggtcga actgcgcacc cgagggccgg ttcaccagga agcacttcgg cgactggacc      1560
     gccccggccg gcgaccggga accgccgatg ctcagcgcgt tcttcactcc cagcgccttc      1620
     gaactggcct ggcacgtgag cggcagcgac ggctgccaga ccctgacctt caccgccccc      1680
     tatgccaagg tccgcgacct gctccagcct tcggtgctgt cactgctgaa cccgtcgccc      1740
     accccgtcct ga                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page