(data stored in ACNUC30630 zone)

EMBL: CP001738.PE38

CP001738.PE38        Location/Qualifiers
FT   CDS_pept        complement(42852..44207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0039"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mch:Mchl_3323
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95647"
FT                   /db_xref="GOA:D1ADD7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D1ADD7"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACY95647.1"
FT                   /translation="MANRAGHRRFGNIRKLPSGRYQARYPGPDGKMRTAPSTFATKGDA
FT                   DRYLTLVEAQILNGEWTDPDRAKVKLGDYAAKWIEQRPGLRPRTVELYERLLRRHIAPY
FT                   LGGVALGKLSTPVIREWRMTLLSEGVSASVTAKAYRLLRAVLTTATEDDRIIPRNPCRI
FT                   RGAGDEKPDERPVLTVPQVFELADRIGRRPVGNVRKLPSGAYRLRYQLPDGSTMRAFPT
FT                   TFTSKAAAEQMLSELADKGEANVRRDDRFRALVLLATFASLRWGEAVALQRQDIDLAAR
FT                   TVTVRRQYLEMDSGDLVLGPTKSRAGARTVVFPAGIVPAIRDHLDRYTADDPAALVFTG
FT                   ANGGVLRRGNFRRASRWGEAVAALGVPGLHFHDLRHTGNTIAARSGASLRDLMRRMGHD
FT                   SVRAALIYQHATSEADKAIAASLDAQIEAAAVADGDGDGDEDGAAGVLAPVG"
     atggccaaca gggcgggcca ccggcgtttc ggcaatatcc gcaagctgcc gtcagggcgc        60
     taccaagccc ggtatccggg gccggacggc aagatgcgta ccgctcccag cacgttcgcc       120
     accaagggcg acgctgatcg gtacctgacc cttgtcgagg cgcagatcct caacggggag       180
     tggacggacc cggaccgggc gaaagtcaag cttggggact acgccgcgaa gtggatcgaa       240
     cagcgtcccg gcctgcggcc ccggacggtg gaactgtacg agcggctgtt gcgtcggcac       300
     atcgcgccgt acctgggcgg tgtcgcgctg ggcaagctga gcactcccgt gatccgggag       360
     tggcgtatga cgctgctcag tgagggcgtg tcggcttcgg tgaccgccaa ggcgtaccgg       420
     ctgctgcgcg cggtcctgac cacggcgacc gaagacgacc ggatcatccc acgcaacccg       480
     tgccgaatcc gcggtgccgg tgatgaaaag ccggatgagc ggccggtgct gaccgttccc       540
     caggtgttcg agctggcgga ccggatcggc cggcggccgg tcggcaatgt ccgcaagctg       600
     ccctcgggtg cctaccggct gcgctaccag ctcccggacg gatcgaccat gcgcgccttc       660
     ccgaccacct tcacgagcaa ggcggcggcc gaacagatgc tctccgagct ggccgacaag       720
     ggggaggcga acgttcgccg tgatgatcgg ttccgggcgt tggtcctgct ggccacgttc       780
     gcgagtctgc gttggggtga ggcggtggcg ctccagcgtc aggacatcga cctggcggcc       840
     cggacggtga cggtacggcg gcaatacctg gagatggact ccggggacct ggtgctcggg       900
     ccgaccaagt cccgtgccgg tgcccgtacc gtcgtcttcc cggcgggcat cgttccggca       960
     atacgcgatc acctcgaccg gtacaccgcc gacgatccgg cggcgctggt gttcaccggg      1020
     gcgaacggtg gtgtgctgcg gcggggcaac ttccggcggg cgtcccggtg gggtgaggcg      1080
     gtggcggcgc tcggcgtccc gggcctgcac ttccacgacc tgcggcatac cggcaacacg      1140
     atcgccgctc ggagcggtgc gagcctgcgg gacctgatgc gccggatggg tcacgactcg      1200
     gtgcgggcgg cgctgatcta ccagcacgcc acgtcggagg cggacaaggc catcgcggca      1260
     tcgctggacg cccagatcga ggcggcggcg gtcgctgacg gtgacggtga cggtgatgag      1320
     gacggcgcgg ccggtgtgct ggcgccggtg ggctaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page