(data stored in ACNUC30630 zone)

EMBL: CP001738.PE381

CP001738.PE381       Location/Qualifiers
FT   CDS_pept        complement(441351..441773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95990"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACY95990.1"
FT                   /translation="MTHATGPSGQPDDATIEAVGKLSEALETVERARGHLYSFHQLIGG
FT                   ADFAVEDAADLLARAGHRQLAEELRRQIMGRNVLPGRWTFQVVEEFDDTYYEPFRAFER
FT                   RVRDELTGGRRHLHEARMKEERRTHGLPGHEATPEG"
     atgacgcacg ccactggtcc gtccgggcaa cccgatgacg ccacgatcga ggcggtcggc        60
     aaactgagcg aggcgctgga gaccgtcgag cgcgcccgcg ggcacctgta ctccttccac       120
     cagctcatcg gcggcgccga cttcgccgtc gaggacgcgg ccgacctgct ggcccgggcc       180
     ggtcaccggc agctggccga ggagctgaga cggcagatca tgggccgcaa cgtgctgccg       240
     ggccggtgga ccttccaggt cgtggaggag ttcgacgaca cctactacga gccgttccgg       300
     gcgttcgaac gccgcgtccg cgacgagctg accggcggcc ggcggcacct gcatgaagcc       360
     cgcatgaagg aggagcgccg cacccacggc ctcccgggcc acgaggccac acccgagggg       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page