(data stored in ACNUC30630 zone)

EMBL: CP001738.PE382

CP001738.PE382       Location/Qualifiers
FT   CDS_pept        442177..443055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tcur_0390"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: atu:Atu2436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tcur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACY95991"
FT                   /db_xref="GOA:D1A2H1"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1A2H1"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ACY95991.1"
FT                   /translation="MKRTLKRALSLLPAAALAASALVAASPAQAAANPYQRGPNPTEAS
FT                   ITAARGPFNTAEITVSRLSVSGFGGGKIYYPTTTSEGTFGAIAISPGFTAYWSSLEWLG
FT                   HRLASQGFVVIGIETNTTLDQPDQRGQQLLAALDYLTQRSAVRDRVDASRLAVAGHSMG
FT                   GGGSLEAAKARTSLKAAIPLAPWNLDKTWPEVRTPTLIIGGELDAVAPVATHSIPFYNS
FT                   LSNAPEKAYLELDNASHFFPNITNTQMAKYMIAWMKRFIDDDTRYTQFLCPPPSTGLLS
FT                   DFSDARFTCPM"
     atgaagcgca ccctcaagag ggccctcagc ctgctgcccg ccgcagcgct ggccgccagc        60
     gccctggtcg ccgcctcccc cgcacaggcg gcggccaacc cctaccagcg gggtcccaac       120
     cccacggagg ccagcatcac cgccgcccgc gggccgttca acaccgctga gatcaccgtc       180
     tcgcggctga gcgtgtccgg cttcggcgga ggcaagatct actacccgac caccaccagc       240
     gagggcacct tcggcgccat cgccatctcg cccggcttca ccgcctactg gtccagcctg       300
     gagtggctgg gccaccggct ggcctcccag ggcttcgtgg tcatcggcat cgagaccaac       360
     accaccctgg accagcccga ccagcgcggt cagcagctgc tggccgccct ggactacctg       420
     acccagcgca gcgcggtccg cgaccgggtg gacgcctcgc gcctggcggt ggccggccac       480
     tcgatgggcg gcggcggctc gctggaggcc gccaaggccc gcacctcgct gaaggccgcc       540
     atcccgctgg ccccctggaa cctggacaag acctggccgg aagtgcgcac cccgaccctg       600
     atcatcggcg gtgagctcga cgccgtcgcg ccggtcgcca cgcactccat cccgttctac       660
     aacagcctgt ccaacgcgcc ggagaaggcc tacctggagc tggacaacgc cagccacttc       720
     ttcccgaaca tcaccaacac ccagatggcc aagtacatga tcgcctggat gaagcggttc       780
     atcgacgatg acacccgcta cacccagttc ctgtgcccgc cgcccagcac cggcctgctg       840
     tcggacttct ccgacgcccg cttcacctgc cccatgtga                              879
//

If you have problems or comments...

PBIL Back to PBIL home page